Recombinant human AKR1C1 protein (ab117472)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ04828
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMDSKYQCVKLNDGHFMPVLGFGTYAPAEVP KSKALEATKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIF YTSKLWCNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIP KDENGKILFDTVDLCATWEAVEKCKDAGLAKSIGVSNFNRRQLEMILNKP GLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDP NSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQN VQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY
    • Molecular weight39 kDa including tags
    • Amino acids1 to 323
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab117472 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activitySpecific activity: approximately 0.15 - 0.2 units/mg. Enzymatic activity was confirmed by measuring the amount of enzyme catalyzing the oxidation of 1 micromole NADPH per minute at 25°C. Specific activity was expressed as units/mg protein.
  • Applications

    Functional Studies

    SDS-PAGE

  • Purity> 90 % SDS-PAGE.
    ab117472 is purified by proprietary chromatographic techniques.
  • FormLiquid
  • Additional notesab117472 is stable at 4°C for 30 days, it should be stored desiccated below -20°C for periods greater than 30 days. Avoid freeze-thaw cycles.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Please see notes section.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 0.02% DTT, 20% Glycerol

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • 2-dihydrobenzene-1
    • 2-diol dehydrogenase
    • 20 alpha (3 alpha) hydroxysteroid dehydrogenase
    • 20 ALPHA HSD
    • 20 alpha hydroxysteroid dehydrogenase
    • 20-alpha-HSD
    • 20-alpha-hydroxysteroid dehydrogenase
    • 20ALPHAHSD
    • 2ALPHAHSD
    • AK1C1
    • AK1C1_HUMAN
    • AKR1C1
    • Aldo keto reductase family 1 member C1
    • aldo-keto reductase C
    • Aldo-keto reductase family 1 member C1
    • Aldo-keto reductase family, 1 member 1
    • C9
    • Chlordecone reductase homolog
    • Chlordecone reductase homolog HAKRC
    • DD1
    • DD1/DD2
    • DDH
    • DDH1
    • Dihydrodiol dehydrogenase 1
    • Dihydrodiol dehydrogenase 1/2
    • dihydrodiol dehydrogenase 1; 20-alpha (3-alpha)-hydroxysteroid dehydrogenase
    • dihydrodiol dehydrogenase isoform DD1
    • Dihydrodiol dehydrogenase, type 1
    • H37
    • HAKRC
    • HBAB
    • Hepatic dihydrodiol dehydrogenase
    • High affinity hepatic bile acid-binding protein
    • High-affinity hepatic bile acid-binding protein
    • Indanol dehydrogenase
    • MBAB
    • MGC8954
    • Trans-1
    • Trans-1,2 dihydrobenzene 1,2 diol dehydrogenase
    • Type II 3 alpha hydroxysteroid dehydrogenase
    see all
  • FunctionConverts progesterone to its inactive form, 20-alpha-dihydroxyprogesterone (20-alpha-OHP). In the liver and intestine, may have a role in the transport of bile. May have a role in monitoring the intrahepatic bile acid concentration. Has a low bile-binding ability. May play a role in myelin formation.
  • Tissue specificityExpressed in all tissues tested including liver, prostate, testis, adrenal gland, brain, uterus, mammary gland and keratinocytes. Highest levels found in liver, mammary gland and brain.
  • Sequence similaritiesBelongs to the aldo/keto reductase family.
  • Cellular localizationCytoplasm.
  • Information by UniProt

References for Recombinant human AKR1C1 protein (ab117472)

ab117472 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab117472.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"