Recombinant Human AKR1C2 protein (ab114785)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP52895
    • SpeciesHuman
    • SequenceEEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYN EQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSD EY
    • Molecular weight37 kDa including tags
    • Amino acids224 to 323

Specifications

Our Abpromise guarantee covers the use of ab114785 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 2-dihydrobenzene-1
    • 2-diol dehydrogenase
    • 3 alpha HSD3
    • 3 alpha hydroxysteroid dehydrogenase type III
    • 3-alpha-HSD3
    • AK1C2_HUMAN
    • AKR1C pseudo
    • AKR1C2
    • Aldo keto reductase family 1 member C2
    • Aldo-keto reductase family 1 member C2
    • BABP
    • Bile acid binding protein
    • Chlordecone reductase homolog
    • Chlordecone reductase homolog HAKRD
    • DD
    • DD-2
    • DD/BABP
    • DD2
    • DDH 2
    • DDH2
    • Dihydrodiol dehydrogenase 2
    • Dihydrodiol dehydrogenase/bile acid binding protein
    • Dihydrodiol dehydrogenase/bile acid-binding protein
    • FLJ53800
    • HAKRD
    • HBAB
    • MCDR 2
    • MCDR2
    • OTTHUMP00000044759
    • Pseudo chlordecone reductase
    • SRXY8
    • Trans 1 2 dihydrobenzene 1 2 diol dehydrogenase
    • Trans-1
    • Type II dihydrodiol dehydrogenase
    • Type III 3 alpha hydroxysteroid dehydrogenase
    • Type III 3-alpha-hydroxysteroid dehydrogenase
    see all
  • FunctionWorks in concert with the 5-alpha/5-beta-steroid reductases to convert steroid hormones into the 3-alpha/5-alpha and 3-alpha/5-beta-tetrahydrosteroids. Catalyzes the inactivation of the most potent androgen 5-alpha-dihydrotestosterone (5-alpha-DHT) to 5-alpha-androstane-3-alpha,17-beta-diol (3-alpha-diol). Has a high bile-binding ability.
  • Sequence similaritiesBelongs to the aldo/keto reductase family.
  • Cellular localizationCytoplasm.
  • Information by UniProt

Recombinant Human AKR1C2 protein images

  • ab114785 on 12.5% SDS-PAGE Stained with Coomassie Blue.

References for Recombinant Human AKR1C2 protein (ab114785)

ab114785 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114785.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"