Recombinant human AKR1C3 protein (ab167984)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMDSKHQCVKLNDGHFMPVLGFGTYAPPEVP RSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIF YTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSP TDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKP GLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDP NSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQN VQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYSDEY
    • Molecular weight
      39 kDa including tags
    • Amino acids
      1 to 323
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab167984 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    Specific activity is approximately < 0.1 units/mg. Enzymatic activity was confirmed by measuring the amount of enzyme catalyzing the oxidation of 1 micromole NADPH per minute at 25°C. Specific activity was expressed as units/mg protein
  • Applications

    SDS-PAGE

    Functional Studies

  • Purity
    >95% by SDS-PAGE .

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 10% Glycerol

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • 17 beta HSD 5
    • 17 beta hydroxysteroid dehydrogenase type 5
    • 17-beta-HSD 5
    • 17-beta-hydroxysteroid dehydrogenase type 5
    • 2-dihydrobenzene-1
    • 2-diol dehydrogenase
    • 20-alpha-hydroxysteroid dehydrogenase
    • 3 alpha hydroxysteroid dehydrogenase type II
    • 3-alpha-HSD type 2
    • 3-alpha-HSD type II
    • 3-alpha-HSD type II, brain
    • 3-alpha-hydroxysteroid dehydrogenase type 2
    • AK1C3_HUMAN
    • AKR1 C3
    • Akr1c18
    • AKR1C3
    • Aldo keto reductase family 1 member C3
    • Aldo-keto reductase family 1 member C3
    • brain
    • Chlordecone reductase
    • Chlordecone reductase homolog HAKRb
    • DD-3
    • DD3
    • DDH1
    • DDX
    • Dihydrodiol dehydrogenase 3
    • Dihydrodiol dehydrogenase type I
    • Dihydrodiol dehydrogenase X
    • HA1753
    • HAKRB
    • HAKRe
    • hluPGFS
    • HSD17B5
    • Indanol dehydrogenase
    • KIAA0119
    • PGFS
    • Prostaglandin F synthase
    • Testosterone 17-beta-dehydrogenase 5
    • Trans-1
    • Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase
    • Type IIb 3 alpha hydroxysteroid dehydrogenase
    see all
  • Function
    Catalyzes the conversion of aldehydes and ketones to alcohols. Catalyzes the reduction of prostaglandin (PG) D2, PGH2 and phenanthrenequinone (PQ) and the oxidation of 9-alpha,11-beta-PGF2 to PGD2. Functions as a bi-directional 3-alpha-, 17-beta- and 20-alpha HSD. Can interconvert active androgens, estrogens and progestins with their cognate inactive metabolites. Preferentially transforms androstenedione (4-dione) to testosterone.
  • Tissue specificity
    Expressed in many tissues including adrenal gland, brain, kidney, liver, lung, mammary gland, placenta, small intestine, colon, spleen, prostate and testis. The dominant HSD in prostate and mammary gland. In the prostate, higher levels in epithelial cells than in stromal cells. In the brain, expressed in medulla, spinal cord, frontotemporal lobes, thalamus, subthalamic nuclei and amygdala. Weaker expression in the hippocampus, substantia nigra and caudate.
  • Sequence similarities
    Belongs to the aldo/keto reductase family.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • 15% SDS PAGE analysis of ab167984 at 3 µg.

References

ab167984 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab167984.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up