Recombinant Human AKR1D1 protein (ab104758)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP51857
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMDLSAASHRIPLSDGNSIPIIGLGTYSEPK STPKGACATSVKVAIDTGYRHIDGAYIYQNEHEVGEAIREKIAEGKVRRE DIFYCGKLWATNHVPEMVRPTLERTLRVLQLDYVDLYIIEVPMAFKPGDE IYPRDENGKWLYHKSNLCATWEAMEACKDAGLVKSLGVSNFNRRQLELIL NKPGLKHKPVSNQVECHPYFTQPKLLKFCQQHDIVITAYSPLGTSRNPIW VNVSSPPLLKDALLNSLGKRYNKTAAQIVLRFNIQRGVVVIPKSFNLERI KENFQIFDFSLTEEEMKDIEALNKNVRFVELLMWRDHPEYPFHDEY
    • Molecular weight40 kDa including tags
    • Amino acids1 to 326
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab104758 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab104758 is purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 20% Glycerol, 20mM Tris HCl, 100mM Sodium chloride, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • 3-oxo-5-beta-steroid 4-dehydrogenase
    • 3o5bred
    • AK1D1_HUMAN
    • AKR1D1
    • Aldo keto reductase family 1 member D1
    • aldo keto reductase family 1 member D1 (delta 4 3 ketosteroid 5 beta reductase)
    • Aldo-keto reductase family 1 member D1
    • CBAS2
    • Delta(4) 3 ketosteroid 5 beta reductase
    • Delta(4) 3 oxosteroid 5 beta reductase
    • Delta(4)-3-ketosteroid 5-beta-reductase
    • Delta(4)-3-oxosteroid 5-beta-reductase
    • SRD5B1
    • steroid 5 beta reductase
    • steroid 5 beta reductase beta polypeptide 1 (3 oxo 5 beta steroid delta 4 dehydrogenase beta 1)
    see all
  • FunctionEfficiently catalyzes the reduction of progesterone, androstenedione, 17-alpha-hydroxyprogesterone and testosterone to 5-beta-reduced metabolites. The bile acid intermediates 7-alpha,12-alpha-dihydroxy-4-cholesten-3-one and 7-alpha-hydroxy-4-cholesten-3-one can also act as substrates.
  • Tissue specificityHighly expressed in liver. Expressed in testis and weakly in colon.
  • Involvement in diseaseCongenital bile acid synthesis defect 2
  • Sequence similaritiesBelongs to the aldo/keto reductase family.
  • Cellular localizationCytoplasm.
  • Information by UniProt

Recombinant Human AKR1D1 protein images

  • 15% SDS-PAGE (3µg).

References for Recombinant Human AKR1D1 protein (ab104758)

ab104758 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab104758.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"