Recombinant Human AKR1D1 protein (ab104758)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMDLSAASHRIPLSDGNSIPIIGLGTYSEPK STPKGACATSVKVAIDTGYRHIDGAYIYQNEHEVGEAIREKIAEGKVRRE DIFYCGKLWATNHVPEMVRPTLERTLRVLQLDYVDLYIIEVPMAFKPGDE IYPRDENGKWLYHKSNLCATWEAMEACKDAGLVKSLGVSNFNRRQLELIL NKPGLKHKPVSNQVECHPYFTQPKLLKFCQQHDIVITAYSPLGTSRNPIW VNVSSPPLLKDALLNSLGKRYNKTAAQIVLRFNIQRGVVVIPKSFNLERI KENFQIFDFSLTEEEMKDIEALNKNVRFVELLMWRDHPEYPFHDEY
    • Molecular weight
      40 kDa including tags
    • Amino acids
      1 to 326
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab104758 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab104758 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 20% Glycerol, 20mM Tris HCl, 100mM Sodium chloride, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • 3-oxo-5-beta-steroid 4-dehydrogenase
    • 3o5bred
    • AK1D1_HUMAN
    • AKR1D1
    • Aldo keto reductase family 1 member D1
    • aldo keto reductase family 1 member D1 (delta 4 3 ketosteroid 5 beta reductase)
    • Aldo-keto reductase family 1 member D1
    • CBAS2
    • Delta(4) 3 ketosteroid 5 beta reductase
    • Delta(4) 3 oxosteroid 5 beta reductase
    • Delta(4)-3-ketosteroid 5-beta-reductase
    • Delta(4)-3-oxosteroid 5-beta-reductase
    • SRD5B1
    • steroid 5 beta reductase
    • steroid 5 beta reductase beta polypeptide 1 (3 oxo 5 beta steroid delta 4 dehydrogenase beta 1)
    see all
  • Function
    Efficiently catalyzes the reduction of progesterone, androstenedione, 17-alpha-hydroxyprogesterone and testosterone to 5-beta-reduced metabolites. The bile acid intermediates 7-alpha,12-alpha-dihydroxy-4-cholesten-3-one and 7-alpha-hydroxy-4-cholesten-3-one can also act as substrates.
  • Tissue specificity
    Highly expressed in liver. Expressed in testis and weakly in colon.
  • Involvement in disease
    Congenital bile acid synthesis defect 2
  • Sequence similarities
    Belongs to the aldo/keto reductase family.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • 15% SDS-PAGE (3µg).

References

ab104758 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab104758.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up