Recombinant human AKT2 protein (ab79798)

Overview

Description

  • NatureRecombinant
  • SourceBaculovirus infected Sf9 cells
  • Amino Acid Sequence
    • AccessionP31751
    • SpeciesHuman
    • SequenceMNEVSVIKEGWLHKRGEYIKTWRPRYFLLKSDGSFIGYKERPEAPDQTLP PLNNFSVAEC QLMKTERPRPNTFVIRCLQWTTVIERTFHVDSPDEREE WMRAIQMVANSLKQRAPGEDPM DYKCGSPSDSSTTEEMEVAVSKARAK VTMNDFDYLKLLGKGTFGKVILVREKATGRYYAM KILRKEVIIAKDEV AHTVTESRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFH LS RERVFTEERARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKIT DFGLCKEG ISDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVM YEMMCGRLPFYNQDHERLFE LILMEEIRFPRTLSPEAKSLLAGLLKKD PKQRLGGGPSDAKEVMEHRFFLSINWQDVVQK KLLPPFKPQVTSEVDT RYFDDEFTAQSITITPPDRYDSLGLLELDQRTHFPQFSYSASIR E
    • Amino acids1 to 481
    • TagsHis tag N-Terminus
    • Additional sequence informationRecombinant full-length human AKT2 was co-expressed with PDK1 by baculovirus infection in Sf9 insect cells.

Specifications

Our Abpromise guarantee covers the use of ab79798 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activitySpecific Activity: 5.9 pmol/min/µg.
  • Applications

    Functional Studies

    SDS-PAGE

    Western blot

  • Purity>90% by SDS-PAGE.

  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Preservative: 0.1% Imidazole
    Constituents: 0.0462% DTT, 0.395% Tris HCl, 50% Glycerol, 0.58% Sodium chloride, Potassium chloride

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • Akt2
    • AKT2_HUMAN
    • HIHGHH
    • murine thymoma viral (v-akt) homolog-2
    • PKB
    • PKB beta
    • PKBB
    • PKBBETA
    • PRKBB
    • Protein kinase Akt 2
    • Protein kinase Akt-2
    • Protein kinase B beta
    • rac protein kinase beta
    • RAC-BETA
    • RAC-beta serine/threonine-protein kinase
    • RAC-PK-beta
    • v akt murine thymoma viral oncogene homolog 2
    see all
  • FunctionGeneral protein kinase capable of phosphorylating several known proteins.
  • Tissue specificityExpressed in all human cell types so far analyzed.
  • Sequence similaritiesBelongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. RAC subfamily.
    Contains 1 AGC-kinase C-terminal domain.
    Contains 1 PH domain.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications
    Phosphorylation on Thr-309 and Ser-474 is required for full activity.
    Ubiquitinated; undergoes both 'Lys-48'- and 'Lys-63'-linked polyubiquitination. TRAF6-induced 'Lys-63'-linked AKT2 ubiquitination. When fully phosphorylated and translocated into the nucleus, undergoes 'Lys-48'-polyubiquitination catalyzed by TTC3, leading to its degradation by the proteasome.
  • Information by UniProt

Recombinant human AKT2 protein images

  • Anti-AKT2 antibody (ab78666) + Recombinant human AKT2 protein (ab79798) at 0.01 µg

    Secondary
    Goat Anti-Rabbit IgG H&L (HRP) preadsorbed (ab97080) at 1/5000 dilution
  • 10% SDS-PAGE showing ab79798 at approximately 57kDa (10µg).

  • Kinase assay: Specific activity 5.9 pmol/min/μg.

References for Recombinant human AKT2 protein (ab79798)

ab79798 has not yet been referenced specifically in any publications.

Product Wall

Thank you for confirming these details and for your cooperation. The details provided enable us to closely monitor the quality of our products.
I am sorry this product did not perform as stated on the datasheet and for the inconvenience this has c...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"