Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      EAIQAVADRLQRQEEERMNCSPTSQIDNIGEEEMDASTTHHKRKTMNDFD YLKLLGKGTFGKVILVREKASGKYYAMKILKKEVIIAKDE
    • Molecular weight
      36 kDa
    • Amino acids
      100 to 189
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160755 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Akt3
    • AKT3 kinase
    • AKT3_HUMAN
    • DKFZp434N0250
    • MPPH
    • PKB gamma
    • PKBG
    • PRKBG
    • Protein kinase Akt-3
    • Protein Kinase AKT3
    • Protein kinase B gamma
    • RAC gamma
    • RAC gamma serine/threonine protein kinase
    • RAC-gamma serine/threonine-protein kinase
    • RAC-PK-gamma
    • RACPK Gamma
    • Serine threonine protein kinase Akt 3
    • Serine threonine protein kinase Akt3
    • STK 2
    • STK-2
    • STK2
    • V akt murine thymoma viral oncogene homolog 3
    • V akt murine thymoma viral oncogene homolog 3 (protein kinase B, gamma)
    • V akt murine thymoma viral oncogene homolog 3 protein kinase B gamma
    see all
  • Function
    IGF-1 leads to the activation of AKT3, which may play a role in regulating cell survival. Capable of phosphorylating several known proteins. Truncated isoform 2/PKB gamma 1 without the second serine phosphorylation site could still be stimulated but to a lesser extent.
  • Tissue specificity
    In adult tissues, it is highly expressed in brain, lung and kidney, but weakly in heart, testis and liver. In fetal tissues, it is highly expressed in heart, liver and brain and not at all in kidney.
  • Sequence similarities
    Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. RAC subfamily.
    Contains 1 AGC-kinase C-terminal domain.
    Contains 1 PH domain.
    Contains 1 protein kinase domain.
  • Domain
    Binding of the PH domain to the phosphatidylinositol 3-kinase alpha (PI(3)K) results in its targeting to the plasma membrane.
  • Post-translational
    modifications
    Phosphorylation on Thr-305 and Ser-472 is required for full activity (By similarity). Phosphorylated upon DNA damage, probably by ATM or ATR.
    Ubiquitinated. When fully phosphorylated and translocated into the nucleus, undergoes 'Lys-48'-polyubiquitination catalyzed by TTC3, leading to its degradation by the proteasome.
  • Cellular localization
    Cytoplasm. Membrane. Membrane-associated after cell stimulation leading to its translocation.
  • Information by UniProt

Images

  • ab160755 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160755 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160755.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up