Overview

Description

  • NatureRecombinant
  • SourceBaculovirus infected Sf9 cells
  • Amino Acid Sequence
    • AccessionQ9Y243
    • SpeciesHuman
    • SequenceMSPIDPMGHHHHHHGRRRASVAAGILVPRGSPGLDGICSIEEFSDVTIVK EGWVQKRGEYIKNWRPRYFLLKTDGSFIGYKEKPQDVDLPYPLNNFSVAK CQLMKTERPKPNTFIIRCLQWTTVIERTFHVDTPEEREEWTEAIQAVADR LQRQEEERMNCSPTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLLGKGT FGKVILVREKASGKYYAMKILKKEVIIAKDEVAHTLTESRVLKNTRHPFL TSLKYSFQTKDRLCFVMEYVNGGELFFHLSRERVFSEDRTRFYGAEIVSA LDYLHSGKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITDAATMKTFCG TPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELI LMEDIKFPRTLSSDAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFSGV NWQDVYDKKLVPPFKPQVTSETDTRYFDEEFTAQTITITPPEKYDEDGMD CMDNERRPHFPQFSYSASGRE
    • Molecular weight60 kDa
    • Amino acids2 to 479
    • TagsHis tag N-Terminus
    • Additional sequence informationSequence includes His tag and linker (with the Thrombin cleavage site)

Specifications

Our Abpromise guarantee covers the use of ab79799 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Specific Activity: 14 pmol/min/µg.

  • Applications

    SDS-PAGE

    Functional Studies

  • Purity> 95 % SDS-PAGE.

  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 10% Glycerol, 0.05% Tween 20, 25mM Tris HCl, 138mM Sodium chloride, pH 8

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • Akt3
    • AKT3 kinase
    • AKT3_HUMAN
    • DKFZp434N0250
    • MPPH
    • PKB gamma
    • PKBG
    • PRKBG
    • Protein kinase Akt-3
    • Protein Kinase AKT3
    • Protein kinase B gamma
    • RAC gamma
    • RAC gamma serine/threonine protein kinase
    • RAC-gamma serine/threonine-protein kinase
    • RAC-PK-gamma
    • RACPK Gamma
    • Serine threonine protein kinase Akt 3
    • Serine threonine protein kinase Akt3
    • STK 2
    • STK-2
    • STK2
    • V akt murine thymoma viral oncogene homolog 3
    • V akt murine thymoma viral oncogene homolog 3 (protein kinase B, gamma)
    • V akt murine thymoma viral oncogene homolog 3 protein kinase B gamma
    see all
  • FunctionIGF-1 leads to the activation of AKT3, which may play a role in regulating cell survival. Capable of phosphorylating several known proteins. Truncated isoform 2/PKB gamma 1 without the second serine phosphorylation site could still be stimulated but to a lesser extent.
  • Tissue specificityIn adult tissues, it is highly expressed in brain, lung and kidney, but weakly in heart, testis and liver. In fetal tissues, it is highly expressed in heart, liver and brain and not at all in kidney.
  • Sequence similaritiesBelongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. RAC subfamily.
    Contains 1 AGC-kinase C-terminal domain.
    Contains 1 PH domain.
    Contains 1 protein kinase domain.
  • DomainBinding of the PH domain to the phosphatidylinositol 3-kinase alpha (PI(3)K) results in its targeting to the plasma membrane.
  • Post-translational
    modifications
    Phosphorylation on Thr-305 and Ser-472 is required for full activity (By similarity). Phosphorylated upon DNA damage, probably by ATM or ATR.
    Ubiquitinated. When fully phosphorylated and translocated into the nucleus, undergoes 'Lys-48'-polyubiquitination catalyzed by TTC3, leading to its degradation by the proteasome.
  • Cellular localizationCytoplasm. Membrane. Membrane-associated after cell stimulation leading to its translocation.
  • Information by UniProt

Recombinant human AKT3 protein images

  • 10% SDS-PAGE, Coomassie staining.
    Lane 1: ab79799 5µg.
    Lane 2: Protein marker.
  • Kinase Assay: Specific Activity 10 pmol/min/µg.

References for Recombinant human AKT3 protein (ab79799)

ab79799 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab79799.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"