Recombinant Human Alanine Transaminase protein (ab113862)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP24298
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMASSTGDRSQAVRHGLRAKVLTLDGMNPRV RRVEYAVRGPIVQRALEL EQELRQGVKKPFTEVIRANIGDAQAMGQRP ITFLRQVLALCVNPDLLSSPNFPDDAKKRAERILQACGGHSLGAY SVS SGIQLIREDVARYIERRDGGIPADPNNVFLSTGASDAIVTVLKLLVAGEG HTRTGVLIPIPQYPLYSATLAE LGAVQVDYYLDEERAWALDVAELHRA LGQARDHCRPRALCVINPGNPTGQVQTRECIEAVIRFAFEERLFLLADE VYQDNVYAAGSQFHSFKKVLMEMGPPYAGQQELASFHSTSKGYMGECGF RGGYVEVVNMDAAVQQQMLKLMSVRL CPPVPGQALLDLVVSPPAPTDP SFAQFQAEKQAVLAELAAKAKLTEQVFNEAPGISCNPVQGAMYSFPRVQL PPR AVERAQELGLAPDMFFCLRLLEETGICVVPGSGFGQREGTYHFRM TILPPLEKLRLLLEKLSRFHAKFTLEYS
    • Molecular weight57 kDa including tags
    • Amino acids1 to 496
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab113862 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab113862 was purified using conventional chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 20% Glycerol, 0.03% DTT

General Info

  • Alternative names
    • AAT1
    • Alanine aminotransferase
    • Alanine aminotransferase 1
    • ALAT1_HUMAN
    • ALT1
    • Glutamate pyruvate transaminase 1
    • Glutamic alanine transaminase 1
    • Glutamic pyruvate transaminase (alanine aminotransferase)
    • Glutamic pyruvic transaminase 1
    • Glutamic--alanine transaminase 1
    • Glutamic--pyruvic transaminase 1
    • gpt
    • GPT 1
    • GPT1
    see all
  • FunctionCatalyzes the reversible transamination between alanine and 2-oxoglutarate to form pyruvate and glutamate. Participates in cellular nitrogen metabolism and also in liver gluconeogenesis starting with precursors transported from skeletal muscles.
  • Tissue specificityLiver, kidney, heart, and skeletal muscles. Expressed at moderate levels in the adipose tissue.
  • PathwayAmino-acid degradation; L-alanine degradation via transaminase pathway; pyruvate from L-alanine: step 1/1.
  • Sequence similaritiesBelongs to the class-I pyridoxal-phosphate-dependent aminotransferase family. Alanine aminotransferase subfamily.
  • Cellular localizationCytoplasm.
  • Information by UniProt

Recombinant Human Alanine Transaminase protein images

  • 15% SDS-PAGE analysis of ab113862 (3ug)

References for Recombinant Human Alanine Transaminase protein (ab113862)

ab113862 has not yet been referenced specifically in any publications.

Product Wall

Thank you for contacting us.

Regrettably, this protein’s biological activity hasn’t been tested yet, and we can’t give you a specific date on when we will test it. I should mention that it hasn’t been exposed to denatur...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"