Recombinant Human Alanine Transaminase protein (ab113862)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMASSTGDRSQAVRHGLRAKVLTLDGMNPRV RRVEYAVRGPIVQRALELEQELRQGVKKPFTEVIRANIGDAQAMGQRPIT FLRQVLALCVNPDLLSSPNFPDDAKKRAERILQACGGHSLGAYSVSSGIQ LIREDVARYIERRDGGIPADPNNVFLSTGASDAIVTVLKLLVAGEGHTRT GVLIPIPQYPLYSATLAELGAVQVDYYLDEERAWALDVAELHRALGQARD HCRPRALCVINPGNPTGQVQTRECIEAVIRFAFEERLFLLADEVYQDNVY AAGSQFHSFKKVLMEMGPPYAGQQELASFHSTSKGYMGECGFRGGYVEVV NMDAAVQQQMLKLMSVRLCPPVPGQALLDLVVSPPAPTDPSFAQFQAEKQ AVLAELAAKAKLTEQVFNEAPGISCNPVQGAMYSFPRVQLPPRAVERAQE LGLAPDMFFCLRLLEETGICVVPGSGFGQREGTYHFRMTILPPLEKLRLL LEKLSRFHAKFTLEYS
    • Molecular weight
      57 kDa including tags
    • Amino acids
      1 to 496
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab113862 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab113862 was purified using conventional chromatography.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 20% Glycerol, 0.03% DTT

General Info

  • Alternative names
    • AAT1
    • Alanine aminotransferase
    • Alanine aminotransferase 1
    • ALAT1_HUMAN
    • ALT1
    • Glutamate pyruvate transaminase 1
    • Glutamic alanine transaminase 1
    • Glutamic pyruvate transaminase (alanine aminotransferase)
    • Glutamic pyruvic transaminase 1
    • Glutamic--alanine transaminase 1
    • Glutamic--pyruvic transaminase 1
    • gpt
    • GPT 1
    • GPT1
    see all
  • Function
    Catalyzes the reversible transamination between alanine and 2-oxoglutarate to form pyruvate and glutamate. Participates in cellular nitrogen metabolism and also in liver gluconeogenesis starting with precursors transported from skeletal muscles.
  • Tissue specificity
    Liver, kidney, heart, and skeletal muscles. Expressed at moderate levels in the adipose tissue.
  • Pathway
    Amino-acid degradation; L-alanine degradation via transaminase pathway; pyruvate from L-alanine: step 1/1.
  • Sequence similarities
    Belongs to the class-I pyridoxal-phosphate-dependent aminotransferase family. Alanine aminotransferase subfamily.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab113862 (3ug)

References

ab113862 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Thank you for contacting us.

Regrettably, this protein’s biological activity hasn’t been tested yet, and we can’t give you a specific date on when we will test it. I should mention that it hasn’t been exposed to denatur...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up