Recombinant Human Alanine Transaminase protein (ab166920)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MASSTGDRSQAVRHGLRAKVLTLDGMNPRVRRVEYAVRGPIVQRALELEQ ELRQGVKKPFTEVIRANIGDAQAMGQRPITFLRQVLALCVNPDLLSSPNF PDDAKKRAERILQACGGHSLGAYSVSSGIQLIREDVARYIERRDGGIPAD PNNVFLSTGASDAIVTVLKLLVAGEGHTRTGVLIPIPQYPLYSATLAELG AVQVDYYLDEERAWALDVAELHRALGQARDHCRPRALCVINPGNPTGQVQ TRECIEAVIRFAFEERLFLLADEVYQDNVYAAGSQFHSFKKVLMEMGPPY AGQQELASFHSTSKGYMGECGFRGGYVEVVNMDAAVQQQMLKLMSVRLCP PVPGQALLDLVVSPPAPTDPSFAQFQAEKQAVLAELAAKAKLTEQVFNEA PGISCNPVQGAMYSFPRVQLPPRAVERAQELGLAPDMFFCLRLLEETGIC VVPGSGFGQREGTYHFRMTILPPLEKLRLLLEELSRFHAKFTLEYS
    • Molecular weight
      80 kDa including tags
    • Amino acids
      1 to 496
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab166920 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl
    Note: Glutathione is reduced

General Info

  • Alternative names
    • AAT1
    • Alanine aminotransferase
    • Alanine aminotransferase 1
    • ALAT1_HUMAN
    • ALT1
    • Glutamate pyruvate transaminase 1
    • Glutamic alanine transaminase 1
    • Glutamic pyruvate transaminase (alanine aminotransferase)
    • Glutamic pyruvic transaminase 1
    • Glutamic--alanine transaminase 1
    • Glutamic--pyruvic transaminase 1
    • gpt
    • GPT 1
    • GPT1
    see all
  • Function
    Catalyzes the reversible transamination between alanine and 2-oxoglutarate to form pyruvate and glutamate. Participates in cellular nitrogen metabolism and also in liver gluconeogenesis starting with precursors transported from skeletal muscles.
  • Tissue specificity
    Liver, kidney, heart, and skeletal muscles. Expressed at moderate levels in the adipose tissue.
  • Pathway
    Amino-acid degradation; L-alanine degradation via transaminase pathway; pyruvate from L-alanine: step 1/1.
  • Sequence similarities
    Belongs to the class-I pyridoxal-phosphate-dependent aminotransferase family. Alanine aminotransferase subfamily.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

References

ab166920 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab166920.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up