Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MDSTLTASEIRQRFIDFFKRNEHTYVHSSATIPLDDPTLLFANAGMNQFK PIFLNTIDPSHPMAKLSRAANTQKCIRAGGKHNDLDDVGKDVYHHTFFEM LGSWSFGDYFKELACKMALELLTQEFGIPIERLYVTYFGGDEAAGLEADL ECKQIWQNLGLDDTKILPGNMKDNFWEMGDTGPCGPCSEIHYDRIGGRDA AHLVNQDDPNVLEIWNLVFIQYNREADGILKPLPKKSIDTGMGLERLVSV LQNKMSNYDTDLFVPYFEAIQKGTGARPYTGKVGAEDADGIDMAYRVLAD HARTITVALADGGRPDNTGRGYVLRRILRRAVRYAHEKLNASRGFFATLV DVVVQSLGDAFPELKKDPDMVKDIINEEEVQFLKTLSRGRRILDRKIQSL GDSKTIPGDTAWLLYDTYGFPVDLTGLIAEEKGLVVDMDGFEEERKLAQL KSQGKGAGGEDLIMLDIYAIEELRARGLEVTDDSPKYNYHLDSSGSYVFE NTVATVMALRREKMFVEEVSTGQECGVVLDKTCFYAEQGGQIYDEGYLVK VDDSSEDKTEFTVKNAQVRGGYVLHIGTIYGDLKVGDQVWLFIDEPRRRP IMSNHTATHILNFALRSVLGEADQKGSLVAPDRLRFDFTAKGAMSTQQIK KAEEIANEMIEAAKAVYTQDCPLAAAKAIQGLRAVFDETYPDPVRVVSIG VPVSELLDDPSGPAGSLTSVEFCGGTHLRNSSHAGAFVIVTEEAIAKGIR RIVAVTGAEAQKALRKAESLKKCLSVMEAKVKAQTAPNKDVQREIADLGE ALATAVIPQWQKDELRETLKSLKKVMDDLDRASKADVQKRVLEKTKQFID SNPNQPLVILEMESGASAKALNEALKLFKMHSPQTSAMLFTVDNEAGKIT CLCQVPQNAANRGLKASEWVQQVSGLMDGKGGGKDVSAQATGKNVGCLQE ALQLATSFAQLRLGDVKN
    • Molecular weight
      106 kDa
    • Amino acids
      1 to 968
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab185603 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C.

    pH: 7.2
    Constituents: 1.17% Sodium chloride, 20% Glycerol, 78% PBS

General Info

  • Alternative names
    • AARS
    • AI316495
    • Alanine tRNA ligase
    • Alanine tRNA ligase 1, cytoplasmic
    • Alanine tRNA ligase cytoplasmic
    • Alanine--tRNA ligase
    • Alanyl tRNA synthetase
    • Alanyl tRNA synthetase cytoplasmic
    • Alanyl-tRNA synthetase
    • AlaRS
    • C76919
    • CMT2N
    • cytoplasmic
    • EC 6.1.1.7
    • MGC37368
    • Renal carcinoma antigen NY REN 42
    • Renal carcinoma antigen NY-REN-42
    • SYAC_HUMAN
    see all
  • Function
    Catalyzes the attachment of alanine to tRNA(Ala) in a two-step reaction: alanine is first activated by ATP to form Ala-AMP and then transferred to the acceptor end of tRNA(Ala). Also edits incorrectly charged tRNA(Ala) via its editing domain.
  • Involvement in disease
    Charcot-Marie-Tooth disease 2N
  • Sequence similarities
    Belongs to the class-II aminoacyl-tRNA synthetase family.
  • Domain
    Consists of three domains; the N-terminal catalytic domain, the editing domain and the C-terminal C-Ala domain. The editing domain removes incorrectly charged amino acids, while the C-Ala domain, along with tRNA(Ala), serves as a bridge to cooperatively bring together the editing and aminoacylation centers thus stimulating deacylation of misacylated tRNAs.
    The C-terminal C-Ala domain (residues 756 to 968), along with tRNA(Ala), serves as a bridge to cooperatively bring together the editing and aminoacylation centers thus stimulating deacylation of misacylated tRNAs. The human domain can be used in vitro to replace the corresponding domain in E.coli.
  • Post-translational
    modifications
    ISGylated.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • SDS-PAGE analysis of 2µg ab185603.

References

ab185603 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185603.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up