Overview

  • Product name
    Recombinant Human Alas1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MESVVRRCPFLSRVPQAFLQKAGKSLLFYAQNCPKMMEVGAKPAPRALST AAVHYQQIKETPPASEKDKTAKAKVQQTPDGSQQSPDGTQLPSGHPLP
    • Molecular weight
      36 kDa including tags
    • Amino acids
      1 to 98

Specifications

Our Abpromise guarantee covers the use of ab114537 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/ul. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 5 aminolevulinate synthase
    • 5 aminolevulinate synthase nonspecific mitochondrial
    • 5 aminolevulinic acid synthase
    • 5-aminolevulinate synthase
    • 5-aminolevulinic acid synthase 1
    • ALAS
    • Alas 1
    • ALAS 3
    • ALAS H
    • ALAS HOUSEKEEPING TYPE
    • ALAS N
    • ALAS-H
    • alaS1
    • ALAS3
    • ALASH
    • Aminolevulinate delta synthase 1
    • Aminolevulinic acid synthase 1
    • Delta ALA synthetase
    • Delta aminolevulinate synthase
    • Delta-ALA synthase 1
    • Delta-aminolevulinate synthase 1
    • HEM1_HUMAN
    • MIG 4
    • MIG4
    • Migration inducing protein 4
    • mitochondrial
    • nonspecific
    see all
  • Pathway
    Porphyrin metabolism; protoporphyrin-IX biosynthesis; 5-aminolevulinate from glycine: step 1/1.
  • Sequence similarities
    Belongs to the class-II pyridoxal-phosphate-dependent aminotransferase family.
  • Cellular localization
    Mitochondrion matrix.
  • Information by UniProt

Recombinant Human Alas1 protein images

  • 12.5% SDS-PAGE showing ab114537 at approximately 36.41kDa stained with Coomassie Blue.

References for Recombinant Human Alas1 protein (ab114537)

ab114537 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114537.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up