Overview

  • Product name
    Recombinant Human Alas1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MESVVRRCPFLSRVPQAFLQKAGKSLLFYAQNCPKMMEVGAKPAPRALST AAVHYQQIKETPPASEKDKTAKAKVQQTPDGSQQSPDGTQLPSGHPLP
    • Molecular weight
      36 kDa including tags
    • Amino acids
      1 to 98

Specifications

Our Abpromise guarantee covers the use of ab114537 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/ul. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 5 aminolevulinate synthase
    • 5 aminolevulinate synthase nonspecific mitochondrial
    • 5 aminolevulinic acid synthase
    • 5-aminolevulinate synthase
    • 5-aminolevulinic acid synthase 1
    • ALAS
    • Alas 1
    • ALAS 3
    • ALAS H
    • ALAS HOUSEKEEPING TYPE
    • ALAS N
    • ALAS-H
    • alaS1
    • ALAS3
    • ALASH
    • Aminolevulinate delta synthase 1
    • Aminolevulinic acid synthase 1
    • Delta ALA synthetase
    • Delta aminolevulinate synthase
    • Delta-ALA synthase 1
    • Delta-aminolevulinate synthase 1
    • HEM1_HUMAN
    • MIG 4
    • MIG4
    • Migration inducing protein 4
    • mitochondrial
    • nonspecific
    see all
  • Pathway
    Porphyrin metabolism; protoporphyrin-IX biosynthesis; 5-aminolevulinate from glycine: step 1/1.
  • Sequence similarities
    Belongs to the class-II pyridoxal-phosphate-dependent aminotransferase family.
  • Cellular localization
    Mitochondrion matrix.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab114537 at approximately 36.41kDa stained with Coomassie Blue.

References

ab114537 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114537.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up