Recombinant Human Alcohol Dehydrogenase protein (ab123147)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMSTAGKVIKCKAAVLWELKKPFSIEEVEVA PPKAHEVRIKMVAVGICGTDDHVVSGTMVTPLPVILGHEAAGIVESVGEG VTTVKPGDKVIPLAIPQCGKCRICKNPESNYCLKNDVSNPQGTLQDGTSR FTCRRKPIHHFLGISTFSQYTVVDENAVAKIDAASPLEKVCLIGCGFSTG YGSAVNVAKVTPGSTCAVFGLGGVGLSAIMGCKAAGAARIIAVDINKDKF AKAKELGATECINPQDYKKPIQEVLKEMTDGGVDFSFEVIGRLDTMMASL LCCHEACGTSVIVGVPPDSQNLSMNPMLLLTGRTWKGAILGGFKSKECVP KLVADFMAKKFSLDALITHVLPFEKINEGFDLLHSGKSIRTILMF
    • Molecular weight
      42 kDa including tags
    • Amino acids
      1 to 375
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab123147 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab123147 was purified using conventional chromatography.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.02% DTT, 0.32% Tris HCl, 10% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names
    • ADH
    • ADH alpha subunit
    • ADH1
    • ADH1A
    • ADH1A_HUMAN
    • Alcohol dehydrogenase 1
    • Alcohol dehydrogenase 1 (class I), alpha polypeptide
    • Alcohol dehydrogenase 1A
    • Alcohol dehydrogenase 1A (class I), alpha polypeptide
    • Alcohol dehydrogenase subunit alpha
    • Aldehyde reductase
    see all
  • Sequence similarities
    Belongs to the zinc-containing alcohol dehydrogenase family.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Recombinant Human Alcohol Dehydrogenase protein images

  • 15% SDS PAGE, 3 µg of ab123147 loaded.

References for Recombinant Human Alcohol Dehydrogenase protein (ab123147)

ab123147 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab123147.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up