Recombinant Human Alcohol Dehydrogenase protein (ab123147)

Overview

  • Product nameRecombinant Human Alcohol Dehydrogenase protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP07327
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMSTAGKVIKCKAAVLWELKKPFSIEEVEVA PPKAHEVRIKMVAVGICGTDDHVVSGTMVTPLPVILGHEAAGIVESVGEG VTTVKPGDKVIPLAIPQCGKCRICKNPESNYCLKNDVSNPQGTLQDGTSR FTCRRKPIHHFLGISTFSQYTVVDENAVAKIDAASPLEKVCLIGCGFSTG YGSAVNVAKVTPGSTCAVFGLGGVGLSAIMGCKAAGAARIIAVDINKDKF AKAKELGATECINPQDYKKPIQEVLKEMTDGGVDFSFEVIGRLDTMMASL LCCHEACGTSVIVGVPPDSQNLSMNPMLLLTGRTWKGAILGGFKSKECVP KLVADFMAKKFSLDALITHVLPFEKINEGFDLLHSGKSIRTILMF
    • Molecular weight42 kDa including tags
    • Amino acids1 to 375
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab123147 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab123147 was purified using conventional chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.02% DTT, 0.32% Tris HCl, 10% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names
    • ADH
    • ADH alpha subunit
    • ADH1
    • ADH1A
    • ADH1A_HUMAN
    • Alcohol dehydrogenase 1
    • Alcohol dehydrogenase 1A
    • Alcohol dehydrogenase subunit alpha
    • Aldehyde reductase
    see all
  • Sequence similaritiesBelongs to the zinc-containing alcohol dehydrogenase family.
  • Cellular localizationCytoplasm.
  • Information by UniProt

Recombinant Human Alcohol Dehydrogenase protein images

  • 15% SDS PAGE, 3 µg of ab123147 loaded.

References for Recombinant Human Alcohol Dehydrogenase protein (ab123147)

ab123147 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab123147.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"