Recombinant Human ALDH1A2 protein (ab125987)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionO94788
    • SpeciesHuman
    • SequenceKPAEQTPLSALYMGALIKEAGFPPGVINILPGYGPTAGAAIASHIGIDKI AFTGSTEVGKLIQEAAGRSNLKRVTLELGGKSPNIIFADADLDYAVEQAH QGVFFNQGQCCTAGSRIFVEESIYEEFVRRSVERAKRRVVGSPFDPTTEQ GPQIDKKQYNKILELIQSGVAEGAKLECGGKGLGRKGFFIEPTVFSNVTD DMRIAKEEIFGPVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALT VSSAMQ
    • Amino acids210 to 465

Associated products

Specifications

Our Abpromise guarantee covers the use of ab125987 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • FormLyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C.

    Constituents: 0.32% Tris HCl, 0.58% Sodium chloride

  • ReconstitutionReconstitute with water to desired concentration.

General Info

  • Alternative names
    • AL1A2_HUMAN
    • Aldehyde dehydrogenase family 1 member A2
    • ALDH1A2
    • ALDH1A2 aldehyde dehydrogenase 1 family, member A2
    • Aldh1a7
    • AV116159
    • MGC26444
    • RALDH 2
    • RALDH(II)
    • Raldh1
    • RalDH2
    • RALDH2 T
    • Retinal dehydrogenase 2
    • Retinaldehyde dehydrogenase 2
    • Retinaldehyde specific dehydrogenase type 2
    • Retinaldehyde-specific dehydrogenase type 2
    see all
  • FunctionRecognizes as substrates free retinal and cellular retinol-binding protein-bound retinal. Does metabolize octanal and decanal but does not metabolize citral, benzaldehyde, acetaldehyde and propanal efficiently.
  • PathwayCofactor metabolism; retinol metabolism.
  • Sequence similaritiesBelongs to the aldehyde dehydrogenase family.
  • Cellular localizationCytoplasm.
  • Information by UniProt

References for Recombinant Human ALDH1A2 protein (ab125987)

ab125987 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab125987.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"