Recombinant Human ALDH1L1 protein (ab153133)

Overview

  • Product name
    Recombinant Human ALDH1L1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      EESFGPVMIISRFADGDLDAVLSRANATEFGLASGVFTRDINKALYVSDK LQAGTVFVNTYNKTDVAAPFGGFKQSGFGKDLGEAALNEYLRVKTVTFEY
    • Amino acids
      803 to 902
    • Tags
      proprietary tag N-Terminus

Associated products

Specifications

Our Abpromise guarantee covers the use of ab153133 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 10 formyltetrahydrofolate dehydrogenase
    • 10 FTHFDH
    • 10-formyltetrahydrofolate dehydrogenase
    • 10-FTHFDH
    • AL1L1_HUMAN
    • Aldehyde dehydrogenase 1 family member L1
    • Aldehyde dehydrogenase family 1 member L1
    • aldh1l1
    • Cytosolic 10-formyltetrahydrofolate dehydrogenase
    • DKFZp781N0997
    • EC 1.5.1.6
    • FDH
    • formyltetrahydrofolate dehydrogenase
    • FTHFD
    • OTTHUMP00000155221
    • OTTHUMP00000214696
    • OTTHUMP00000214700
    • OTTHUMP00000222724
    see all
  • Tissue specificity
    Highly expressed in liver, pancreas and kidney.
  • Sequence similarities
    In the N-terminal section; belongs to the GART family.
    In the C-terminal section; belongs to the aldehyde dehydrogenase family. ALDH1L subfamily.
    Contains 1 acyl carrier domain.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • ab153133 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153133 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153133.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up