Recombinant Human ALDH5A1 protein (ab99429)

Overview

  • Product nameRecombinant Human ALDH5A1 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP51649
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMAGRLAGLSAALLRTDSFVGGRWLPAAATF PVQDPASGAALGMVADCGVREARAAVRAAYEAFCRWREVSAKERSSLLRK WYNLMIQNKDDLARIITAESGKPLKEAHGEILYSAFFLEWFSEEARRVYG DIIHTPAKDRRALVLKQPIGVAAVITPWNFPSAMITRKVGAALAAGCTVV VKPAEDTPFSALALAELASQAGIPSGVYNVIPCSRKNAKEVGEAICTDPL VSKISFTGSTTTGKILLHHAANSVKRVSMELGGLAPFIVFDSANVDQAVA GAMASKFRNTGQTCVCSNQFLVQRGIHDAFVKAFAEAMKKNLRVGNGFEE GTTQGPLINEKAVEKVEKQVNDAVSKGATVVTGGKRHQLGKNFFEPTLLC NVTQDMLCTHEETFGPLAPVIKFDTEEEAIAIANAADVGLAGYFYSQDPA QIWRVAEQLEVGMVGVNEGLISSVECPFGGVKQSGLGREGSKYGIDEYLE LKYVCYGGL
    • Molecular weight55 kDa including tags
    • Amino acids48 to 535
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab99429 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab99429 is purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM EDTA, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • Aldedehyde dehydrogenase 5 family
    • Aldehyde dehydrogenase 5 family member A1
    • Aldehyde dehydrogenase 5A1
    • Aldehyde dehydrogenase family 5 member A1
    • ALDH5A 1
    • Aldh5a1
    • mitochondrial
    • Mitochondrial succinate semialdehyde dehydrogenase
    • NAD(+) dependent succinic semialdehyde dehydrogenase
    • NAD(+)-dependent succinic semialdehyde dehydrogenase
    • SSADH
    • SSDH
    • SSDH_HUMAN
    • Succinate semialdehyde dehydrogenase
    • Succinate-semialdehyde dehydrogenase
    see all
  • FunctionCatalyzes one step in the degradation of the inhibitory neurotransmitter gamma-aminobutyric acid (GABA).
  • Tissue specificityBrain, pancreas, heart, liver, skeletal muscle and kidney. Lower in placenta.
  • PathwayAmino-acid degradation; 4-aminobutanoate degradation.
  • Involvement in diseaseDefects in ALDH5A1 are the cause of succinate semialdehyde dehydrogenase deficiency (SSADH deficiency) [MIM:271980]. SSADH deficiency is a rare inborn error in the metabolism of 4-aminobutyric acid (GABA) which leads to accumulation of 4-hydroxybutyric acid in physiologic fluids of patients. The disease is characterized by severe ataxia and by mildly retarded psychomotor development.
  • Sequence similaritiesBelongs to the aldehyde dehydrogenase family.
  • Cellular localizationMitochondrion.
  • Information by UniProt

Recombinant Human ALDH5A1 protein images

  • 15% SDS-PAGE showing ab99429 at approximately 54.6kDa (3µg).

References for Recombinant Human ALDH5A1 protein (ab99429)

ab99429 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab99429.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"