Recombinant Human ALDH5A1 protein (ab99429)

Overview

  • Product name
    Recombinant Human ALDH5A1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMAGRLAGLSAALLRTDSFVGGRWLPAAATF PVQDPASGAALGMVADCGVREARAAVRAAYEAFCRWREVSAKERSSLLRK WYNLMIQNKDDLARIITAESGKPLKEAHGEILYSAFFLEWFSEEARRVYG DIIHTPAKDRRALVLKQPIGVAAVITPWNFPSAMITRKVGAALAAGCTVV VKPAEDTPFSALALAELASQAGIPSGVYNVIPCSRKNAKEVGEAICTDPL VSKISFTGSTTTGKILLHHAANSVKRVSMELGGLAPFIVFDSANVDQAVA GAMASKFRNTGQTCVCSNQFLVQRGIHDAFVKAFAEAMKKNLRVGNGFEE GTTQGPLINEKAVEKVEKQVNDAVSKGATVVTGGKRHQLGKNFFEPTLLC NVTQDMLCTHEETFGPLAPVIKFDTEEEAIAIANAADVGLAGYFYSQDPA QIWRVAEQLEVGMVGVNEGLISSVECPFGGVKQSGLGREGSKYGIDEYLE LKYVCYGGL
    • Molecular weight
      55 kDa including tags
    • Amino acids
      48 to 535
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab99429 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab99429 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM EDTA, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • Aldedehyde dehydrogenase 5 family
    • Aldehyde dehydrogenase 5 family member A1
    • Aldehyde dehydrogenase 5A1
    • Aldehyde dehydrogenase family 5 member A1
    • ALDH5A 1
    • Aldh5a1
    • mitochondrial
    • Mitochondrial succinate semialdehyde dehydrogenase
    • NAD(+) dependent succinic semialdehyde dehydrogenase
    • NAD(+)-dependent succinic semialdehyde dehydrogenase
    • SSADH
    • SSDH
    • SSDH_HUMAN
    • Succinate semialdehyde dehydrogenase
    • Succinate-semialdehyde dehydrogenase
    see all
  • Function
    Catalyzes one step in the degradation of the inhibitory neurotransmitter gamma-aminobutyric acid (GABA).
  • Tissue specificity
    Brain, pancreas, heart, liver, skeletal muscle and kidney. Lower in placenta.
  • Pathway
    Amino-acid degradation; 4-aminobutanoate degradation.
  • Involvement in disease
    Defects in ALDH5A1 are the cause of succinate semialdehyde dehydrogenase deficiency (SSADH deficiency) [MIM:271980]. SSADH deficiency is a rare inborn error in the metabolism of 4-aminobutyric acid (GABA) which leads to accumulation of 4-hydroxybutyric acid in physiologic fluids of patients. The disease is characterized by severe ataxia and by mildly retarded psychomotor development.
  • Sequence similarities
    Belongs to the aldehyde dehydrogenase family.
  • Cellular localization
    Mitochondrion.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab99429 at approximately 54.6kDa (3µg).

References

ab99429 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab99429.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up