Recombinant Human ALDH6A1 protein (ab152535)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      VRARILQVSSKVKSSPTWYSASSFSSSVPTVKLFIGGKFVESKSDKWIDI HNPATNEVIGRVPQATKAEMDAAIASCKRAFPAWADTSVLSRQQVLLRYQ QLIKENLKEIAKLITLEQGKTLADAEGDVFRGLQVVEHACSVTSLMMGET MPSITKDMDLYSYRLPLGVCAGIAPFNFPAMIPLWMFPMAMVCGNTFLMK PSERVPGATMLLAKLLQDSGAPDGTLNIIHGQHEAVNFICDHPDIKAISF VGSNKAGEYIFERGSRHGKRVQANMGAKNHGVVMPDANKENTLNQLVGAA FGAAGQRCMALSTAVLVGEAKKWLPELVEHAKNLRVNAGDQPGADLGPLI TPQAKERVCNLIDSGTKEGASILLDGRKIKVKGYENGNFVGPTIISNVKP NMTCYKEEIFGPVLVVLETETLDEAIQIVNNNPYGNGTAIFTTNGATARK YAHLVDVGQVGVNVPIPVPLPMFSFTGSRSSFRGDTNFYGKQGIQFYTQL KTITSQWKEEDATLSSPAVVMPTMGR
    • Molecular weight
      83 kDa including tags
    • Amino acids
      10 to 535

Specifications

Our Abpromise guarantee covers the use of ab152535 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 1110038I05Rik
    • AI314632
    • Aldehyde dehydrogenase 6 family member A1
    • Aldehyde dehydrogenase family 6 member A1
    • Aldehyde dehydrogenase family 6, subfamily A1
    • ALDH6A1
    • Malonate semialdehyde dehydrogenase
    • Malonate-semialdehyde dehydrogenase [acylating]
    • Methylmalonate semialdehyde dehydrogenase [acylating] mitochondrial
    • Methylmalonate-semialdehyde dehydrogenase [acylating]
    • MGC37325
    • MGC40271
    • mitochondrial
    • Mitochondrial acylating methylmalonate semialdehyde dehydrogenase
    • MMSA_HUMAN
    • MMSADHA
    • MMSDH
    see all
  • Function
    Plays a role in valine and pyrimidine metabolism. Binds fatty acyl-CoA.
  • Involvement in disease
    Defects in ALDH6A1 are the cause of methylmalonate semialdehyde dehydrogenase deficiency (MMSDH deficiency) [MIM:603178]. This is characterized by elevated beta-alanine, 3-hydroxypropionic acid, and both isomers of 3-amino and 3-hydroxyisobutyric acids in urine organic acids.
  • Sequence similarities
    Belongs to the aldehyde dehydrogenase family.
  • Cellular localization
    Mitochondrion.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152535 stained with Coomassie Blue.

References

ab152535 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152535.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up