Recombinant Human ALDH7A1 protein (ab157820)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MESESESGAAADTPPLETLSFHGDEEIIEVVELDPGPPDPDDLAQEMEDV DFEEEEEEEGNEEGWVLEPQEGVVGSMEGPDDSEVTFALHSASVFCVSLD PKTNTLAVTGGEDDKAFVWRLSDGELLFECAGHKDSVTCAGFSHDSTLVA TGDMSGLLKVWQVDTKEEVWSFEAGDLEWMEWHPRAPVLLAGTADGNTWM WKVPNGDCKTFQGPNCPATCGRVLPDGKRAVVGYEDGTIRIWDLKQGSPI HVLKGTEGHQGPLTCVAANQDGSLILTGSVDCQAKLVSATTGKVVGVFRP ETVASQPSLGEGEESESNSVESLGFCSVMPLAAVGYLDGTLAIYDLATQT LRHQCQHQSGIVQLLWEAGTAVVYTCSLDGIVRLWDARTGRLLTDYRGHT AEILDFALSKDASLVVTTSGDHKAKVFCVQRPDR
    • Amino acids
      1 to 434
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab157820 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 26g turgor protein homolog
    • AL7A1_HUMAN
    • Aldehyde dehydrogenase 7 A1
    • Aldehyde dehydrogenase 7 family, member A1
    • Aldehyde dehydrogenase family 7 member A1
    • ALDH7A1
    • Alpha AASA dehydrogenase
    • Alpha aminoadipic semialdehyde dehydrogenase
    • Alpha-AASA dehydrogenase
    • Alpha-aminoadipic semialdehyde dehydrogenase
    • Antiquitin
    • Antiquitin 1
    • Antiquitin-1
    • ATQ1
    • Betaine aldehyde dehydrogenase
    • Delta1 piperideine 6 carboxylate dehydrogenease
    • Delta1-piperideine-6-carboxylate dehydrogenase
    • EPD
    • P6c dehydrogenase
    • PDE
    see all
  • Information by UniProt

Images

  • ab157820 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab157820 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab157820.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up