Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP05062
    • SpeciesHuman
    • SequenceDSQGKLFRNILKEKGIVVGIKLDQGGAPLAGTNKETTIQGLDGLSERCAQ YKKDGVDFGKWRAVLRIADQCPSSLAIQENANA
    • Molecular weight35 kDa including tags
    • Amino acids88 to 170

Associated products

Specifications

Our Abpromise guarantee covers the use of ab116880 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ALDB
    • ALDO B
    • ALDO2
    • ALDOB
    • ALDOB_HUMAN
    • Aldolase 2
    • Aldolase B
    • Aldolase B fructose bisphosphate
    • Aldolase2
    • AldolaseB
    • EC 4.1.2.13
    • Fructose bisphosphate aldolase B
    • Fructose-bisphosphate aldolase B
    • Liver type aldolase
    • Liver-type aldolase
    • MS1077
    see all
  • PathwayCarbohydrate degradation; glycolysis; D-glyceraldehyde 3-phosphate and glycerone phosphate from D-glucose: step 4/4.
  • Involvement in diseaseDefects in ALDOB are the cause of hereditary fructose intolerance (HFI) [MIM:229600]. HFI is an autosomal recessive disease that results in an inability to metabolize fructose and related sugars. Complete exclusion of fructose results in dramatic recovery; however, if not treated properly, HFI subjects suffer episodes of hypoglycemia, general ill condition, and risk of death the remainder of life.
  • Sequence similaritiesBelongs to the class I fructose-bisphosphate aldolase family.
  • Information by UniProt

Recombinant Human ALDOB protein images

  • 12.5% SDS-PAGE showing ab116880 at approximately 34.76kDa stained with Coomassie Blue.

References for Recombinant Human ALDOB protein (ab116880)

ab116880 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116880.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"