Recombinant Human Aldolase B protein (ab116880)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      DSQGKLFRNILKEKGIVVGIKLDQGGAPLAGTNKETTIQGLDGLSERCAQ YKKDGVDFGKWRAVLRIADQCPSSLAIQENANA
    • Molecular weight
      35 kDa including tags
    • Amino acids
      88 to 170

Specifications

Our Abpromise guarantee covers the use of ab116880 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ALDB
    • ALDO B
    • ALDO2
    • ALDOB
    • ALDOB_HUMAN
    • Aldolase 2
    • Aldolase B
    • Aldolase B fructose bisphosphate
    • Aldolase2
    • AldolaseB
    • EC 4.1.2.13
    • Fructose bisphosphate aldolase B
    • Fructose-bisphosphate aldolase B
    • Liver type aldolase
    • Liver-type aldolase
    • MS1077
    see all
  • Pathway
    Carbohydrate degradation; glycolysis; D-glyceraldehyde 3-phosphate and glycerone phosphate from D-glucose: step 4/4.
  • Involvement in disease
    Defects in ALDOB are the cause of hereditary fructose intolerance (HFI) [MIM:229600]. HFI is an autosomal recessive disease that results in an inability to metabolize fructose and related sugars. Complete exclusion of fructose results in dramatic recovery; however, if not treated properly, HFI subjects suffer episodes of hypoglycemia, general ill condition, and risk of death the remainder of life.
  • Sequence similarities
    Belongs to the class I fructose-bisphosphate aldolase family.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab116880 at approximately 34.76kDa stained with Coomassie Blue.

References

ab116880 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116880.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up