Recombinant Human Aldolase B protein (ab123165)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSHMAHRFPALTQEQKKELSEIAQSIVAN GKGILAADESVGTMGNRLQRIKVENTEENRRQFREILFSVDSSINQSIGG VILFHETLYQKDSQGKLFRNILKEKGIVVGIKLDQGGAPLAGTNKETTIQ GLDGLSERCAQYKKDGVDFGKWRAVLRIADQCPSSLAIQENANALARYAS ICQQNGLVPIVEPEVIPDGDHDLEHCQYVTEKVLAAVYKALNDHHVYLEG TLLKPNMVTAGHACTKKYTPEQVAMATVTALHRTVPAAVPGICFLSGGMS EEDATLNLNAINLCPLPKPWKLSFSYGRALQASALAAWGGKAANKEATQE AFMKRAMANCQAAKGQYVHTGSSGAASTQSLFTACYTY
    • Molecular weight
      42 kDa including tags
    • Amino acids
      1 to 364
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab123165 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab123165 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.02% DTT, 0.32% Tris HCl, 10% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names
    • ALDB
    • ALDO B
    • ALDO2
    • ALDOB
    • ALDOB_HUMAN
    • Aldolase 2
    • Aldolase B
    • Aldolase B fructose bisphosphate
    • Aldolase2
    • AldolaseB
    • EC 4.1.2.13
    • Fructose bisphosphate aldolase B
    • Fructose-bisphosphate aldolase B
    • Liver type aldolase
    • Liver-type aldolase
    • MS1077
    see all
  • Pathway
    Carbohydrate degradation; glycolysis; D-glyceraldehyde 3-phosphate and glycerone phosphate from D-glucose: step 4/4.
  • Involvement in disease
    Defects in ALDOB are the cause of hereditary fructose intolerance (HFI) [MIM:229600]. HFI is an autosomal recessive disease that results in an inability to metabolize fructose and related sugars. Complete exclusion of fructose results in dramatic recovery; however, if not treated properly, HFI subjects suffer episodes of hypoglycemia, general ill condition, and risk of death the remainder of life.
  • Sequence similarities
    Belongs to the class I fructose-bisphosphate aldolase family.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab123165 (3 µg) at approximately 42 kDa.

References

ab123165 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab123165.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up