Recombinant Human Aldolase protein (ab88287)

Overview

  • Product nameRecombinant Human Aldolase protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceSaccharomyces cerevisiae
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceMPYQYPALTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTE NTEENRRFY RQLLLTADDRVNPCIGGVILFHETLYQKADDGRPFPQVI KSKGGVVGIKVDKGVVPLAG TNGETTTQGLDGLSERCAQYKKDGADFA KWRCVLKIGEHTPSALAIMENANVLARYASI CQQNGIVPIVEPEILPD GDHDLKRCQYVTEKVLAAVYKALSDHHIYLEGTLLKPNMVTP GHACTQ KFSHEEIAMATVTALRRTVPPAVTGITFLSGGQSEEEASINLNAINKCPL LKP WALTFSYGRALQASALKAWGGKKENLKAAQEEYVKRALANSLACQ GKYTPSGQAGAAAS ESLFVSNHAY

Specifications

Our Abpromise guarantee covers the use of ab88287 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

  • Purity> 90 % SDS-PAGE.
    ab88287 was purified by affinity chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5

General Info

  • Alternative names
    • ALDA
    • Aldo1
    • ALDOA
    • ALDOA_HUMAN
    • Aldolase 1
    • Aldolase A
    • Aldolase A fructose bisphosphatase
    • Aldolase A fructose bisphosphate
    • FRUCTOALDOLASE A
    • Fructose 1 6 bisphosphate triosephosphate lyase
    • Fructose bisphosphate aldolase
    • Fructose bisphosphate aldolase A
    • FRUCTOSE-1,6-BISPHOSPHATE ALDOLASE A
    • Fructose-bisphosphate aldolase A
    • Fructose-bisphosphate aldolase A Muscle-type
    • GSD12
    • Lung cancer antigen NY LU 1
    • Lung cancer antigen NY-LU-1
    • MGC10942
    • MGC17716
    • MGC17767
    • Muscle type aldolase
    • Muscle-type aldolase
    • RNALDOG5
    see all
  • FunctionPlays a key role in glycolysis and gluconeogenesis. In addition, may also function as scaffolding protein.
  • PathwayCarbohydrate degradation; glycolysis; D-glyceraldehyde 3-phosphate and glycerone phosphate from D-glucose: step 4/4.
  • Involvement in diseaseDefects in ALDOA are the cause of glycogen storage disease type 12 (GSD12) [MIM:611881]; also known as red cell aldolase deficiency. A metabolic disorder associated with increased hepatic glycogen and hemolytic anemia. It may lead to myopathy with exercise intolerance and rhabdomyolysis.
  • Sequence similaritiesBelongs to the class I fructose-bisphosphate aldolase family.
  • Information by UniProt

References for Recombinant Human Aldolase protein (ab88287)

ab88287 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab88287.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"