Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MACLNPVPKLYRSVIEDVIEGVRNLFAEEGIEEQVLKDLKQLWETKVLQS KATEDFFRNSIQSPLFTLQLPHSLHQTLQSSTASLVIPAGRTLPSFTTAE LGTSNSSANFTFPGYPIHVPAGVTLQTVSGHLYKVNVPIMVTETSGRAGI LQHPIQQVFQQLGQPSVIQTSVPQLNPWSLQATTEKSQRIETVLQQPAIL PSGPVDRKHLENATSDILVSPGNEHKIVPEALLCHQESSHYISLPGVVFS PQVSQTNSNVESVLSGSASMAQNLHDESLSTSPHGALHQHVTDIQLHILK NRMYGCDSVKQPRNIEEPSNIPVSEKDSNSQVDLSIRVTDDDIGEIIQVD GSGDTSSNEEIGSTRDADENEFLGNIDGGDLKVPEEEADSISNEDSATNS SDNEDPQVNIVEEDPLNSGDDVSEQDVPDLFDTDNVIVCQYDKIHRSKNK WKFYLKDGVMCFGGRDYVFAKAIGDAEW
    • Amino acids
      1 to 478
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161254 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 1-like factor
    • General transcription factor II A
    • General transcription factor II A 1 like factor
    • general transcription factor IIA, 1-like
    • GTF2A1-like factor
    • Gtf2a1l
    • GTF2A1LF
    • SALF
    • Stonin 1
    • TF2AY_HUMAN
    • TFIIA alpha and beta like factor
    • TFIIA large subunit isoform ALF
    • TFIIA-alpha and beta-like factor
    • TFIIA-alpha/beta-like factor
    see all
  • Function
    May function as a testis specific transcription factor. Binds DNA in conjunction with GTF2A2 and TBP (the TATA-binding protein) and together with GTF2A2, allows mRNA transcription.
  • Tissue specificity
    Testis specific.
  • Sequence similarities
    Belongs to the TFIIA subunit 1 family.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab161254 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161254 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161254.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up