Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAPLLLQLAVLGAALAAAALVLISIVAFTTATKMPALHRHEEEKFFLNAK GQKETLPSIWDSPTKQLSVVVPSYNEEKRLPVMMDEALSYLEKRQKRDPA FTYEVIVVDDGSKDQTSKVAFKYCQKYGSDKVRVITLVKNRGKGGAIRMG IFSSRGEKILMADADGATKFPDVEKLEKGLNDLQPWPNQMAIACGSRAHL EKESIAQRSYFRTLLMYGFHFLVWFLCVKGIRDTQCGFKLFTREAASRTF SSLHVERWAFDVELLYIAQFFKIPIAEIAVNWTEIEGSKLVPFWSWLQMG KDLLFIRLRYLTGAWRLEQTRKMN
    • Amino acids
      1 to 324
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162244 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ALG5
    • Alg5, S. cerevisiae, homolog of
    • ALG5_HUMAN
    • Asparagine linked glycosylation 5
    • Asparagine-linked glycosylation protein 5 homolog
    • Dolichyl phosphate beta glucosyltransferase
    • Dolichyl-phosphate beta-glucosyltransferase
    • DolP glucosyltransferase
    • DolP-glucosyltransferase
    see all
  • Tissue specificity
    Expressed in pancreas, placenta, liver, heart, brain, kidney, skeletal muscle, and lung.
  • Pathway
    Protein modification; protein glycosylation.
  • Sequence similarities
    Belongs to the glycosyltransferase 2 family.
  • Cellular localization
    Endoplasmic reticulum membrane.
  • Information by UniProt

Images

  • ab162244 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162244 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162244.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up