Recombinant human ALK protein (Active) (ab187246)

Overview

Description

  • Nature
    Recombinant
  • Source
    Baculovirus infected Sf9 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      RRKHQELQAMQMELQSPEYKLSKLRTSTIMTDYNPNYCFAGKTSSISDLK EVPRKNITLIRGLGHGAFGEVYEGQVSGMPNDPSPLQVAVKTLPEVCSEQ DELDFLMEALIISKFNHQNIVRCIGVSLQSLPRFILLELMAGGDLKSFLR ETRPRPSQPSSLAMLDLLHVARDIACGCQYLEENHFIHRDIAARNCLLTC PGPGRVAKIGDFGMARDIYRASYYRKGGCAMLPVKWMPPEAFMEGIFTSK TDTWSFGVLLWEIFSLGYMPYPSKSNQEVLEFVTSGGRMDPPKNCPGPVY RIMTQCWQHQPEDRPNFAIILERIEYCTQDPDVINTALPIEYGPLVEEEE KVPVRPKDPEGVPPLLVSQQAKREEERSPAAPPPLPTTSSGKAAKKPTAA EISVRVPRGPAVEGGHVNMAFSQSNPPSELHKVHGSRNKPTSLWNPTYGS WFTEKPTKKNNPIAKKEPHDRGNLGLEGSCTVPPNVATGRLPGASLLLEP SSLTANMKEVPLFRLRHFPCGNVNYGYQQQGLPLEAATAPGAGHYEDTIL KSKNSMNQPGP
    • Molecular weight
      90 kDa including tags
    • Amino acids
      1060 to 1620
    • Tags
      proprietary tag N-Terminus
    • Additional sequence information
      (NM_004304).

Associated products

Specifications

Our Abpromise guarantee covers the use of ab187246 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    The specific activity of ab187246 was determined to be 24 nmol/min/mg.

  • Applications

    Functional Studies

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes

    ab204862 (IRS1 peptide) can be utilized as a substrate for assessing kinase activity

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.00
    Preservative: 1.02% Imidazole
    Constituents: 0.71% Sodium phosphate, 1.75% Sodium chloride, 0.002% PMSF, 0.004% DTT, 25% Glycerol

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • Alk
    • ALK tyrosine kinase receptor
    • ALK/EML4 fusion gene, included
    • ALK/NPM1 fusion gene, included
    • ALK_HUMAN
    • Anaplastic lymphoma kinase
    • anaplastic lymphoma kinase (Ki-1)
    • Anaplastic lymphoma kinase Ki1
    • anaplastic lymphoma receptor tyrosine kinase
    • CD 246
    • CD246
    • CD246 antigen
    • EC 2.7.10.1
    • Ki 1
    • Ki1
    • mutant anaplastic lymphoma kinase
    • NBLST 3
    • NBLST3
    • Tcrz
    • TFG/ALK
    see all
  • Function
    Neuronal receptor tyrosine kinase that is essentially and transiently expressed in specific regions of the central and peripheral nervous systems and plays an important role in the genesis and differentiation of the nervous system. Transduces signals from ligands at the cell surface, through specific activation of the mitogen-activated protein kinase (MAPK) pathway. Phosphorylates almost exclusively at the first tyrosine of the Y-x-x-x-Y-Y motif. Following activation by ligand, ALK induces tyrosine phosphorylation of CBL, FRS2, IRS1 and SHC1, as well as of the MAP kinases MAPK1/ERK2 and MAPK3/ERK1. Acts as a receptor for ligands pleiotrophin (PTN), a secreted growth factor, and midkine (MDK), a PTN-related factor, thus participating in PTN and MDK signal transduction. PTN-binding induces MAPK pathway activation, which is important for the anti-apoptotic signaling of PTN and regulation of cell proliferation. MDK-binding induces phosphorylation of the ALK target insulin receptor substrate (IRS1), activates mitogen-activated protein kinases (MAPKs) and PI3-kinase, resulting also in cell proliferation induction. Drives NF-kappa-B activation, probably through IRS1 and the activation of the AKT serine/threonine kinase. Recruitment of IRS1 to activated ALK and the activation of NF-kappa-B are essential for the autocrine growth and survival signaling of MDK.
  • Tissue specificity
    Expressed in brain and CNS. Also expressed in the small intestine and testis, but not in normal lymphoid cells.
  • Involvement in disease
    A chromosomal aberration involving ALK is found in a form of non-Hodgkin lymphoma. Translocation t(2;5)(p23;q35) with NPM1. The resulting chimeric NPM1-ALK protein homodimerize and the kinase becomes constitutively activated. The constitutively active fusion proteins are responsible for 5-10% of non-Hodgkin lymphomas.
    A chromosomal aberration involving ALK is associated with inflammatory myofibroblastic tumors (IMTs). Translocation t(2;11)(p23;p15) with CARS; translocation t(2;4)(p23;q21) with SEC31A.
    A chromosomal aberration involving ALK is associated with anaplastic large-cell lymphoma (ALCL). Translocation t(2;17)(p23;q25) with ALO17.
    Neuroblastoma 3
    The ALK signaling pathway plays an important role in glioblastoma, the most common malignant brain tumor of adults and one of the most lethal cancers. It regulates both glioblastoma migration and growth.
    A chromosomal aberration involving ALK is found in one subject with colorectal cancer. Translocation t(2;2)(p23.1;p23.3). A 5 million base pair tandem duplication generates an in-frame WDCP-ALK gene fusion.
  • Sequence similarities
    Belongs to the protein kinase superfamily. Tyr protein kinase family. Insulin receptor subfamily.
    Contains 1 LDL-receptor class A domain.
    Contains 2 MAM domains.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications
    Phosphorylated at tyrosine residues by autocatalysis, which activates kinase activity. In cells not stimulated by a ligand, receptor protein tyrosine phosphatase beta and zeta complex (PTPRB/PTPRZ1) dephosphorylates ALK at the sites in ALK that are undergoing autophosphorylation through autoactivation. Phosphorylation at Tyr-1507 is critical for SHC1 association.
    N-glycosylated.
  • Cellular localization
    Cell membrane. Membrane attachment was crucial for promotion of neuron-like differentiation and cell proliferation arrest through specific activation of the MAP kinase pathway.
  • Information by UniProt

Images

  • Kinase assay showing the specific activity of ab187246 as 24 nmol/min/mg.

  • SDS-PAGE analysis of ab187246.

References

ab187246 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab187246.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up