Recombinant Human Alkaline Phosphatase, Tissue Non-Specific protein (ab114267)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      WRDQAQETLKYALELQKLNTNVAKNVIMFLGDGMGVSTVTAARILKGQLH HNPGEETRLEMDKFPFVALSKTYNTNAQVPDSAGTATAYLCGVKANEGTV GVSAATERSR
    • Molecular weight
      38 kDa including tags
    • Amino acids
      29 to 138

Specifications

Our Abpromise guarantee covers the use of ab114267 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml. This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AKP2
    • Alkaline phosphatase liver/bone/kidney
    • Alkaline phosphatase liver/bone/kidney isozyme
    • Alkaline phosphatase tissue nonspecific isozyme
    • Alkaline phosphatase, tissue-nonspecific isozyme
    • Alkaline phosphomonoesterase
    • Alpl
    • AP TNAP
    • AP-TNAP
    • APTNAP
    • BAP
    • FLJ40094
    • FLJ93059
    • Glycerophosphatase
    • HOPS
    • Liver/bone/kidney type alkaline phosphatase
    • MGC161443
    • MGC167935
    • PHOA
    • PPBT_HUMAN
    • Tissue non specific alkaline phosphatase
    • Tissue nonspecific ALP
    • TNAP
    • TNSALP
    see all
  • Function
    This isozyme may play a role in skeletal mineralization.
  • Involvement in disease
    Hypophosphatasia
    Hypophosphatasia childhood type
    Hypophosphatasia infantile type
  • Sequence similarities
    Belongs to the alkaline phosphatase family.
  • Post-translational
    modifications
    N-glycosylated.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Recombinant Human Alkaline Phosphatase, Tissue Non-Specific protein images

  • ab114267 analysed by 12.5% SDS-PAGE and stained with Coomassie Blue.

References for Recombinant Human Alkaline Phosphatase, Tissue Non-Specific protein (ab114267)

ab114267 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114267.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up