Recombinant Human ALKBH3 protein (ab105620)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ96Q83
    • SpeciesHuman
    • SequenceMRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSELDMEEKRRRARVQ GAWAAPVKSQAIAQPATTAKSHLHQKPGQTWKNKEHHLSDREFVFKEPQQ VVRRAPEPRVIDREGVYEISLSPTGVSRVCLYPGFVDVKEADWILEQLCQ DVPWKQRTGIREDITYQQPRLTAWYGELPYTYSRITMEPNPHWHPVLRTL KNRIEENTGHTFNSLLCNLYRNEKDSVDWHSDDEPSLGRCPIIASLSFGA TRTFEMRKKPPPEENGDYTYVERVKIPLDHGTLLIMEGATQADWQHRVPK EYHSREPRVNLTFRTVYPDPRGAPW
    • Molecular weight38 kDa including tags
    • Amino acids1 to 286
    • TagsHis tag N-Terminus , DDDDK tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab105620 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab105620 was purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 2mM DTT, pH 8.0

General Info

  • Alternative names
    • 1700108H04Rik
    • 1810020C19Rik
    • ABH3
    • AlkB homolog 3
    • alkB, alkylation repair homolog 3 (E. coli)
    • ALKB3_HUMAN
    • ALKBH3
    • Alkylated DNA repair protein alkB homolog 3
    • alkylation repair homolog 3
    • Alpha-ketoglutarate-dependent dioxygenase alkB homolog 3
    • DEPC 1
    • DEPC-1
    • DEPC1
    • EC 1.14.11.
    • FLJ43614
    • mABH3
    • MGC118790
    • MGC118792
    • MGC118793
    • MGC134125
    • PCA1
    • Prostate cancer antigen 1
    • Prostate cancer antigen-1
    • RP23-375N21.4
    see all
  • FunctionDioxygenase that repairs alkylated DNA containing 1-methyladenine and 3-methylcytosine by oxidative demethylation. Has a strong preference for single-stranded DNA. May also act on RNA. Requires molecular oxygen, alpha-ketoglutarate and iron.
  • Tissue specificityUbiquitous. Detected in heart, pancreas, skeletal muscle, thymus, testis, ovary, spleen, prostate, small intestine, peripheral blood leukocytes, urinary bladder and colon.
  • Sequence similaritiesBelongs to the alkB family.
    Contains 1 Fe2OG dioxygenase domain.
  • Cellular localizationCytoplasm. Nucleus.
  • Information by UniProt

Recombinant Human ALKBH3 protein images

  • 15% SDS-PAGE analysis of ab105620 (3µg)

References for Recombinant Human ALKBH3 protein (ab105620)

ab105620 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab105620.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"