Recombinant Human ALKBH5 protein (ab162879)

Overview

  • Product name
    Recombinant Human ALKBH5 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAAASGYTDLREKLKSMTSRDNYKAGSREAAAAAAAAVAAAAAAAAAAEP YPVSGAKRKYQEDSDPERSDYEEQQLQKEEEARKVKSGIRQMRLFSQDEC AKIEARIDEVVSRAEKGLYNEHTVDRAPLRNKYFFGEGYTYGAQLQKRGP GQERLYPPGDVDEIPEWVHQLVIQKLVEHRVIPEGFVNSAVINDYQPGGC IVSHVDPIHIFERPIVSVSFFSDSALCFGCKFQFKPIRVSEPVLSLPVRR GSVTVLSGYAADEITHCIRPQDIKERRAVIILRKTRLDAPRLETKSLSSS VLPPSYASDRLSGNNRDPALKPKRSHRKADPDAAHRPRILEMDKEENRRS VLLPTHRRRGSFSSENYWRKSYESSEDCSEAAGSPGNSGSSLRSCPSFCF EGFVFVHWGVFVFCFLFFLILYIFPWFCCLLGLKNRIGQDLGSHILGIPP GWKGCWHQ
    • Amino acids
      1 to 458
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162879 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ABH5
    • AlkB, alkylation repair homolog 5
    • AlkB, alkylation repair homolog 5 (E. coli)
    • Alkylated DNA repair protein alkB homolog 5
    • Alpha ketoglutarate dependent dioxygenase alkB homolog 5
    • OFOXD
    • OFOXD1
    • Oxoglutarate and iron-dependent oxygenase domain containing
    • Probable alpha ketoglutarate dependent dioxygenase ABH5
    • RNA demethylase ALKBH5
    see all
  • Relevance
    Dioxygenase that demethylates RNA by oxidative demethylation: specifically demethylates N(6)-methyladenosine (m6A) RNA, the most prevalent internal modification of messenger RNA (mRNA) in higher eukaryotes. Requires molecular oxygen, alpha-ketoglutarate and iron. Demethylation of m6A mRNA affects mRNA processing and export and is required for spermatogenesis.
  • Cellular localization
    Nucleus speckle

Images

  • ab162879 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162879 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162879.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up