Recombinant Human ALKBH7 protein (ab164545)

Overview

  • Product name
    Recombinant Human ALKBH7 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAGTGLLALRTLPGPSWVRGSGPSVLSRLQDAAVVRPGFLSTAEEETLSR ELEPELRRRRYEYDHWDAAIHGFRETEKSRWSEASRAILQRVQAAAFGPG QTLLSSVHVLDLEARGYIKPHVDSIKFCGATIAGLSLLSPSVMRLVHTQE PGEWLELLLEPGSLYILRGSARYDFSHEILRDEESFFGERRIPRGRRISV ICRSLPEGMGPGESGQPPPAC
    • Amino acids
      1 to 221
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164545 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ABH7
    • ALKB7_HUMAN
    • ALKBH7
    • Alkylated DNA repair protein alkB homolog 7
    • MGC10974
    • Probable alpha-ketoglutarate-dependent dioxygenase ABH7
    • SPATA11
    • Spermatogenesis cell proliferation-related protein
    • Spermatogenesis-associated protein 11
    • UNQ6002
    • UNQ6002/PRO34564
    see all
  • Function
    Probable dioxygenase that requires molecular oxygen, alpha-ketoglutarate and iron.
  • Tissue specificity
    Widely expressed, with highest expression in pancreas, followed by spleen, prostate, ovary and placenta.
  • Sequence similarities
    Belongs to the alkB family.
  • Cellular localization
    Cytoplasm. Nucleus. Secreted. Has a predicted N-terminal signal sequence, indicating it may be secreted. Detected in cytoplasm and nucleus when expressed as fusion protein with an N-terminal tag.
  • Information by UniProt

Images

  • ab164545 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164545 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164545.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up