Recombinant Human Alpha 1 Acid Glycoprotein (denatured) (ab109931)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MQIPLCANLVPVPITNATLDQITGKWFYIASAFRNEEYNKSVQEIQATFF YFTPNKTEDTIFLREYQTRQDQCIYNTTYLNVQRENGTISRYVGGQEHFA HLLILRDTKTYMLAFDVNDEKNWGLSVYADKPETTKEQLGEFYEALDCLR IPKSDVVYTDWKKDKCEPLEKQHEKERKQEEGES
    • Molecular weight
      22 kDa
    • Amino acids
      19 to 201

Specifications

Our Abpromise guarantee covers the use of ab109931 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    > 90 % SDS-PAGE.
    ab109931 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 2.4% Urea, 5% Glycerol

General Info

  • Alternative names
    • A1AG1_HUMAN
    • AGP
    • AGP 1
    • AGP A
    • AGP1
    • Alpha 1 acid glycoprotein
    • Alpha-1-acid glycoprotein 1
    • alpha-1-AGP
    • Epididymis secretory sperm binding protein Li 153w
    • glycoprotein, alpha-1-acid, of serum
    • HEL S 153w
    • OMD 1
    • ORM
    • ORM1
    • Orosomucoid 1
    • Orosomucoid-1
    see all
  • Function
    Appears to function in modulating the activity of the immune system during the acute-phase reaction.
  • Tissue specificity
    Expressed by the liver and secreted in plasma.
  • Sequence similarities
    Belongs to the calycin superfamily. Lipocalin family.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab109931 at approximately 21.7kDa (3µg).

References

ab109931 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab109931.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up