Recombinant Human Alpha 1 Acid Glycoprotein (denatured) (ab109931)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP02763
    • SpeciesHuman
    • SequenceMQIPLCANLVPVPITNATLDQITGKWFYIASAFRNEEYNKSVQEIQATFF YFTPNKTEDTIFLREYQTRQDQCIYNTTYLNVQRENGTISRYVGGQEHFA HLLILRDTKTYMLAFDVNDEKNWGLSVYADKPETTKEQLGEFYEALDCLR IPKSDVVYTDWKKDKCEPLEKQHEKERKQEEGES
    • Molecular weight22 kDa
    • Amino acids19 to 201

Associated products

Specifications

Our Abpromise guarantee covers the use of ab109931 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 90 % SDS-PAGE.
    ab109931 is purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 2.4% Urea, 5% Glycerol

General Info

  • Alternative names
    • A1AG1_HUMAN
    • AGP
    • AGP 1
    • AGP A
    • AGP1
    • Alpha 1 acid glycoprotein
    • Alpha-1-acid glycoprotein 1
    • Epididymis secretory sperm binding protein Li 153w
    • HEL S 153w
    • OMD 1
    • ORM
    • ORM1
    • Orosomucoid 1
    • Orosomucoid-1
    see all
  • FunctionAppears to function in modulating the activity of the immune system during the acute-phase reaction.
  • Tissue specificityExpressed by the liver and secreted in plasma.
  • Sequence similaritiesBelongs to the calycin superfamily. Lipocalin family.
  • Cellular localizationSecreted.
  • Information by UniProt

Recombinant Human Alpha 1 Acid Glycoprotein (denatured) images

  • 15% SDS-PAGE showing ab109931 at approximately 21.7kDa (3µg).

References for Recombinant Human Alpha 1 Acid Glycoprotein (denatured) (ab109931)

ab109931 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab109931.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"