Recombinant Human alpha 1 Antichymotrypsin protein (ab152025)

Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      HPNSPLDEENLTQENQDRGTHVDLGLASANVDFAFSLYKQLVLKAPDKNV IFSPLSISTALAFLSLGAHNTTLTEILKGLKFNLTETSEAEIHQSFQHLL RTLNQSSDELQLSMGNAMFVKEQLSLLDRFTEDAKRLYGSEAFATDFQDS AAAKKLINDYVKNGTRGKITDLIKDLDSQTMMVLVNYIFFKAKWEMPFDP QDTHQSRFYLSKKKWVMVPMMSLHHLTIPYFRDEELSCTVVELRYTGNAS ALFILPDQDKMEEVEAMLLPETLKRWRDSLEFREIGELYLPKFSISRDYN LNDILLQLGIEEAFTSKADLSGITGARNLAVSQVVHKAVLDVFEEGTEAS AATAVKITLLSALVETRTIVRFNRPFLMIIVPTDTQNIFFMSKVTNPKQA VDHHHHHH
    • Molecular weight
      46 kDa including tags
    • Amino acids
      24 to 423
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab152025 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    Purity is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C long term.

    pH: 7.50
    Constituents: 0.48% HEPES, 0.88% Sodium chloride

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. Dissolve the lyophilized protein in 1X PBS. It is not recommended to reconstitute to a concentration less than 100 µg/ml.
    Reconstituted protein solution can be stored at 4-7°C for 2-7 days. For long term storage aliquot and store at < -20°C.

General Info

  • Alternative names
    • SERPINA3
    • AACT
    • AACT_HUMAN
    • ACT
    • Alpha-1-antichymotrypsin His-Pro-less
    • Antichymotrypsin
    • Cell growth inhibiting gene 24/25 protein
    • Cell growth-inhibiting gene 24/25 protein
    • GIG24
    • GIG25
    • Growth inhibiting protein 24
    • Growth inhibiting protein 25
    • MGC88254
    • Serine (or cysteine) proteinase inhibitor clade A (alpha 1 antiproteinase, antitrypsin) member 3
    • Serine (or cysteine) proteinase inhibitor clade A member 3
    • Serine proteinase inhibitor clade A member 3
    • Serpin A3
    • Serpin family A member 3
    • Serpin peptidase inhibitor clade A (alpha 1 antiproteinase antitrypsin) member 3
    • SERPINA3
    see all
  • Function
    Although its physiological function is unclear, it can inhibit neutrophil cathepsin G and mast cell chymase, both of which can convert angiotensin-1 to the active angiotensin-2.
  • Tissue specificity
    Plasma. Synthesized in the liver. Like the related alpha-1-antitrypsin, its concentration increases in the acute phase of inflammation or infection. Found in the amyloid plaques from the hippocampus of Alzheimer disease brains.
  • Involvement in disease
    Defects in SERPINA3 may be a cause of chronic obstructive pulmonary disease (COPD) [MIM:107280].
  • Sequence similarities
    Belongs to the serpin family.
  • Domain
    The reactive center loop (RCL) extends out from the body of the protein and directs binding to the target protease. The protease cleaves the serpin at the reactive site within the RCL, establishing a covalent linkage between the carboxyl group of the serpin reactive site and the serine hydroxyl of the protease. The resulting inactive serpin-protease complex is highly stable.
  • Cellular localization
    Secreted.
  • Information by UniProt

References

ab152025 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152025.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up