Recombinant Human alpha 1 Fetoprotein (ab112246)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      CCTSSYANRRPCFSSLVVDETYVPPAFSDDKFIFHKDLCQAQGVALQTMK QEFLINLVKQKPQITEEQLEAVIADFSGLLEKCCQGQEQEVCFAEEGQKL ISKTRAALGV
    • Molecular weight
      38 kDa including tags
    • Amino acids
      500 to 609
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab112246 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Afp
    • AFPD
    • Alpha fetoglobulin
    • Alpha fetoprotein
    • Alpha fetoprotein precursor
    • Alpha-1-fetoprotein
    • Alpha-fetoglobulin
    • Alpha-fetoprotein
    • alpha-fetoprotein, Hereditary persistence of, included
    • FETA
    • FETA_HUMAN
    • Hereditary persistence of alpha fetoprotein
    • HPAFP
    see all
  • Function
    Binds copper, nickel, and fatty acids as well as, and bilirubin less well than, serum albumin. Only a small percentage (less than 2%) of the human AFP shows estrogen-binding properties.
  • Tissue specificity
    Plasma. Synthesized by the fetal liver and yolk sac.
  • Sequence similarities
    Belongs to the ALB/AFP/VDB family.
    Contains 3 albumin domains.
  • Developmental stage
    Occurs in the plasma of fetuses more than 4 weeks old, reaches the highest levels during the 12th-16th week of gestation, and drops to trace amounts after birth. The serum level in adults is usually less than 40 ng/ml. AFP occurs also at high levels in the plasma and ascitic fluid of adults with hepatoma.
  • Post-translational
    modifications
    Independent studies suggest heterogeneity of the N-terminal sequence of the mature protein and of the cleavage site of the signal sequence.
    Sulfated.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • 12.5% SDS page analysis of ab112246

References

ab112246 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab112246.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up