Recombinant Human alpha 1 Fetoprotein (ab112246)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP02771
    • SpeciesHuman
    • SequenceCCTSSYANRRPCFSSLVVDETYVPPAFSDDKFIFHKDLCQAQGVALQTMK QEFLINLVKQKPQITEEQLEAVIADFSGLLEKCCQGQEQEVCFAEEGQKL ISKTRAALGV
    • Molecular weight38 kDa including tags
    • Amino acids500 to 609
    • TagsGST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab112246 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • FormLiquid
  • Additional notesBest use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Afp
    • Alpha fetoglobulin
    • Alpha fetoprotein
    • Alpha fetoprotein precursor
    • Alpha-1-fetoprotein
    • Alpha-fetoglobulin
    • Alpha-fetoprotein
    • alpha-fetoprotein, Hereditary persistence of, included
    • FETA
    • FETA_HUMAN
    • Hereditary persistence of alpha fetoprotein
    • HPAFP
    see all
  • FunctionBinds copper, nickel, and fatty acids as well as, and bilirubin less well than, serum albumin. Only a small percentage (less than 2%) of the human AFP shows estrogen-binding properties.
  • Tissue specificityPlasma. Synthesized by the fetal liver and yolk sac.
  • Sequence similaritiesBelongs to the ALB/AFP/VDB family.
    Contains 3 albumin domains.
  • Developmental stageOccurs in the plasma of fetuses more than 4 weeks old, reaches the highest levels during the 12th-16th week of gestation, and drops to trace amounts after birth. The serum level in adults is usually less than 40 ng/ml. AFP occurs also at high levels in the plasma and ascitic fluid of adults with hepatoma.
  • Post-translational
    modifications
    Independent studies suggest heterogeneity of the N-terminal sequence of the mature protein and of the cleavage site of the signal sequence.
    Sulfated.
  • Cellular localizationSecreted.
  • Information by UniProt

Recombinant Human alpha 1 Fetoprotein images

  • 12.5% SDS page analysis of ab112246

References for Recombinant Human alpha 1 Fetoprotein (ab112246)

ab112246 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab112246.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"