Recombinant Human alpha 1 Fetoprotein (ab114216)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP02771
    • SpeciesHuman
    • SequenceMKWVESIFLIFLLNFTESRTLHRNEYGIASILDSYQCTAEISLADLATIF FAQFVQEATYKEVSKMVKDALTAIE KPTGDEQSSGCLENQLPAFLEEL CHEKEILEKYGHSDCCSQSEEGRHNCFLAHKKPTPASIPLFQVPEPVTSC EA YEEDRETFMNKFIYEIARRHPFLYAPTILLWAARYDKIIPSCCKAE NAVECFQTKAATVTKELRESSLLNQHACA VMKNFGTRTFQAITVTKLS QKFTKVNFTEIQKLVLDVAHVHEHCCRGDVLDCLQDGEKIMSYICSQQDT LSNKIT ECCKLTTLERGQCIIHAENDEKPEGLSPNLNRFLGDRDFNQF SSGEKNIFLASFVHEYSRRHPQLAVSVILRVAK GYQELLEKCFQTENP LECQDKGEEELQKYIQESQALAKRSCGLFQKLGEYYLQNAFLVAYTKKAP QLTSSELMAI TRKMAATAATCCQLSEDKLLACGEGAADIIIGHLCIRH EMTPVNTGVGQCCTSSYANRRPCFSSLVVDETYVPPA FSDDKFIFHKD LCQAQGVALQTMKQEFLINLVKQKPQITEEQLEAVIADFSGLLEKCCQGQ EQEVCFAEEGQKLI SKTRAALGV
    • Molecular weight93 kDa including tags
    • Amino acids1 to 609

Specifications

Our Abpromise guarantee covers the use of ab114216 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesBest use within three months from the date of receipt of this protein.
    Protein concentration is lot specific and is above or equal to 0.05 mg/ml
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Afp
    • Alpha fetoglobulin
    • Alpha fetoprotein
    • Alpha fetoprotein precursor
    • Alpha-1-fetoprotein
    • Alpha-fetoglobulin
    • Alpha-fetoprotein
    • alpha-fetoprotein, Hereditary persistence of, included
    • FETA
    • FETA_HUMAN
    • Hereditary persistence of alpha fetoprotein
    • HPAFP
    see all
  • FunctionBinds copper, nickel, and fatty acids as well as, and bilirubin less well than, serum albumin. Only a small percentage (less than 2%) of the human AFP shows estrogen-binding properties.
  • Tissue specificityPlasma. Synthesized by the fetal liver and yolk sac.
  • Sequence similaritiesBelongs to the ALB/AFP/VDB family.
    Contains 3 albumin domains.
  • Developmental stageOccurs in the plasma of fetuses more than 4 weeks old, reaches the highest levels during the 12th-16th week of gestation, and drops to trace amounts after birth. The serum level in adults is usually less than 40 ng/ml. AFP occurs also at high levels in the plasma and ascitic fluid of adults with hepatoma.
  • Post-translational
    modifications
    Independent studies suggest heterogeneity of the N-terminal sequence of the mature protein and of the cleavage site of the signal sequence.
    Sulfated.
  • Cellular localizationSecreted.
  • Information by UniProt

Recombinant Human alpha 1 Fetoprotein images

  • ab114216 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human alpha 1 Fetoprotein (ab114216)

This product has been referenced in:
  • Zhang A  et al. A Chemiluminescent Protein Microarray Method for Determining the Seroglycoid Fucosylation Index. Sci Rep 6:31132 (2016). Read more (PubMed: 27528397) »

See 1 Publication for this product

Product Wall

Thank you for your enquiry.


The purity of ab114216 varies from batch to batch.

Generally, the purity is above 80%.

I hope this information is helpful to you. Please do not hesitate to contact us if you need any mor...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"