Recombinant Human alpha 1 Glycine Receptor protein (ab114750)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP23415
    • SpeciesHuman
    • SequenceIWKPDLFFANEKGAHFHEITTDNKLLRISRNGNVLYSIRITLTLACPMDL KNFPMDVQTCIMQLESFGYTMNDLIFEWQEQGAVQVADGLTLPQFILKEE
    • Molecular weight37 kDa including tags
    • Amino acids121 to 220

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114750 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • GLRA1
    • GLRA1_HUMAN
    • Glycine receptor 48 kDa subunit
    • Glycine receptor alpha 1
    • Glycine receptor strychnine-binding subunit
    • Glycine receptor subunit alpha-1
    • Glycine receptor, alpha 1 subunit
    • HKPX1
    • STHE
    see all
  • FunctionThe glycine receptor is a neurotransmitter-gated ion channel. Binding of glycine to its receptor increases the chloride conductance and thus produces hyperpolarization (inhibition of neuronal firing).
  • Involvement in diseaseDefects in GLRA1 are a cause of startle disease (STHE) [MIM:149400]; also known as hereditary hyperekplexia or congenital stiff-person syndrome. STHE is a genetically heterogeneous neurologic disorder characterized by muscular rigidity of central nervous system origin, particularly in the neonatal period, and by an exaggerated startle response to unexpected acoustic or tactile stimuli. Inheritance can be autosomal dominant or recessive.
  • Sequence similaritiesBelongs to the ligand-gated ion channel (TC 1.A.9) family. Glycine receptor (TC 1.A.9.3) subfamily. GLRA1 sub-subfamily.
  • Cellular localizationCell junction > synapse > postsynaptic cell membrane. Cell membrane.
  • Information by UniProt

Recombinant Human alpha 1 Glycine Receptor protein images

  • 12.5% SDS-PAGE Stained with Coomassie Blue showing ab114750 at approximately 36.63kDa.

References for Recombinant Human alpha 1 Glycine Receptor protein (ab114750)

ab114750 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114750.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"