Recombinant Human alpha 1,2 Mannosidase IA protein (ab114842)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      PGDPEAALEDNLARIRENHERALREAKETLQKLPEEIQRDILLEKKKVAQ DQLRDKAPFRGLPPVDFVPPIGVESREPADAAIREKRAKI
    • Molecular weight
      36 kDa including tags
    • Amino acids
      110 to 199

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114842 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 2-alpha-mannosidase IA
    • 2-mannosidase IA
    • Alpha 1,2 mannosidase IA
    • Alpha-1
    • EC 3.2.1.113
    • HUMM3
    • HUMM9
    • MA1A1_HUMAN
    • Man(9) alpha mannosidase
    • Man(9)-alpha-mannosidase
    • MAN1A1
    • MAN9
    • Man9 mannosidase
    • Man9-mannosidase
    • Mannosidase alpha class 1A member 1
    • Mannosyl-oligosaccharide 1
    • Mannosyl-oligosaccharide 1,2 alpha mannosidase IA
    • OTTHUMP00000017107
    • Processing alpha 1,2 mannosidase IA
    • Processing alpha-1
    see all
  • Function
    Involved in the maturation of Asn-linked oligosaccharides. Progressively trim alpha-1,2-linked mannose residues from Man(9)GlcNAc(2) to produce Man(5)GlcNAc(2).
  • Pathway
    Protein modification; protein glycosylation.
  • Sequence similarities
    Belongs to the glycosyl hydrolase 47 family.
  • Cellular localization
    Golgi apparatus membrane.
  • Information by UniProt

Images

  • ab114842 analysed by 12.5% SDS-PAGE and stained with Coomassie Blue.

References

ab114842 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114842.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up