Recombinant Human alpha 1,2 Mannosidase IA protein (ab114842)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP33908
    • SpeciesHuman
    • SequencePGDPEAALEDNLARIRENHERALREAKETLQKLPEEIQRDILLEKKKVAQ DQLRDKAPFRGLPPVDFVPPIGVESREPADAAIREKRAKI
    • Molecular weight36 kDa including tags
    • Amino acids110 to 199

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114842 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 2-alpha-mannosidase IA
    • 2-mannosidase IA
    • Alpha 1,2 mannosidase IA
    • Alpha-1
    • EC 3.2.1.113
    • HUMM3
    • HUMM9
    • MA1A1_HUMAN
    • Man(9) alpha mannosidase
    • Man(9)-alpha-mannosidase
    • MAN1A1
    • MAN9
    • Man9 mannosidase
    • Man9-mannosidase
    • Mannosidase alpha class 1A member 1
    • Mannosyl-oligosaccharide 1
    • Mannosyl-oligosaccharide 1,2 alpha mannosidase IA
    • OTTHUMP00000017107
    • Processing alpha 1,2 mannosidase IA
    • Processing alpha-1
    see all
  • FunctionInvolved in the maturation of Asn-linked oligosaccharides. Progressively trim alpha-1,2-linked mannose residues from Man(9)GlcNAc(2) to produce Man(5)GlcNAc(2).
  • PathwayProtein modification; protein glycosylation.
  • Sequence similaritiesBelongs to the glycosyl hydrolase 47 family.
  • Cellular localizationGolgi apparatus membrane.
  • Information by UniProt

Recombinant Human alpha 1,2 Mannosidase IA protein images

  • ab114842 analysed by 12.5% SDS-PAGE and stained with Coomassie Blue.

References for Recombinant Human alpha 1,2 Mannosidase IA protein (ab114842)

ab114842 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114842.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"