Recombinant Human Alpha 2 Antiplasmin protein (ab152615)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MVLLWGLLVLSWSCLQGPCSVFSPVSAMEPLGRQLTSGPNQEQVSPLTLL KLGNQEPGGQTALKSPPGVCSRDPTPEQTHRLARAMMAFTADLFSLVAQT STCPNLILSPLSVALALSHLALGAQNHTLQRLQQVLHAGSGPCLPHLLSR LCQDLGPGAFRLAARMYLQKGFPIKEDFLEQSEQLFGAKPVSLTGKQEDD LANINQWVKEATEGKIQEFLSGLPEDTVLLLLNAIHFQGFWRNKFDPSLT QRDSFHLDEQFTVPVEMMQARTYPLRWFLLEQPEIQVAHFPFKNNMSFVV LVPTHFEWNVSQVLANLSWDTLHPPLVWERPTKVRLPKLYLKHQMDLVAT LSQLGLQELFQAPDLRGISEQSLVVSGVQHQSTLELSEVGVEAAAATSIA MSRMSLSSFSVNRPFLFFIFEDTTGLPLFVGSVRNPNPSAPRELKEQQDS PGNKDFLQSLKGFPRGDKLFGPDLKLVPPMEEDYPQFGSPK
    • Molecular weight
      81 kDa including tags

Specifications

Our Abpromise guarantee covers the use of ab152615 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • A2AP
    • A2AP_HUMAN
    • AAP
    • Alpha 2 antiplasmin
    • Alpha 2 antiplasmin pigment epithelium derived factor
    • Alpha 2 AP
    • ALPHA 2 PI
    • Alpha 2 plasmin inhibitor
    • Alpha 2 plasmin inhibitor deficiency
    • Alpha-2-antiplasmin
    • Alpha-2-AP
    • Alpha-2-PI
    • Alpha-2-plasmin inhibitor
    • Antiplasmin deficiency
    • API
    • Plasmin inhibitor deficiency
    • PLI
    • Serine (or cysteine) peptidase inhibitor, clade F, member 2
    • Serine (Or cysteine) peptidase inhibitor, clade F, member 2, isoform CRA_c
    • Serine (or cysteine) proteinase inhibitor, clade F (alpha 2 antiplasmin pigment epithelium derived factor) member 2
    • Serine (Or cysteine) proteinase inhibitor, clade F, member 2
    • Serine or cysteine peptidase inhibitor clade F member 2
    • Serpin F2
    • Serpin peptidase inhibitor clade F
    • Serpin peptidase inhibitor, clade F (alpha 2 antiplasmin pigment epithelium derived factor) member 2
    • SERPINF2
    see all
  • Function
    Serine protease inhibitor. The major targets of this inhibitor are plasmin and trypsin, but it also inactivates matriptase-3/TMPRSS7 and chymotrypsin.
  • Tissue specificity
    Expressed by the liver and secreted in plasma.
  • Involvement in disease
    Defects in SERPINF2 are the cause of alpha-2-plasmin inhibitor deficiency (APLID) [MIM:262850]. APLID is an autosomal recessive disorder resulting in severe hemorrhagic diathesis.
  • Sequence similarities
    Belongs to the serpin family.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152615 stained with Coomassie Blue.

References

ab152615 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152615.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up