Recombinant Human alpha 2 Glycine Receptor protein (ab114545)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP23416
    • SpeciesHuman
    • SequenceLLRISKNGKVLYSIRLTLTLSCPMDLKNFPMDVQTCTMQLESFGYTMNDL IFEWLSDGPVQVAEGLTLPQFILKEEKELGYCTKHYNTGKFTCIEVKFHL ER
    • Molecular weight37 kDa including tags
    • Amino acids151 to 252

Specifications

Our Abpromise guarantee covers the use of ab114545 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • GLR
    • Glra2
    • GLRA2_HUMAN
    • Glycine receptor alpha 2 polypeptide
    • Glycine receptor alpha 2 subunit
    • Glycine receptor subunit alpha 2
    • Glycine receptor subunit alpha-2
    • Gycine receptor alpha 2
    see all
  • FunctionThe glycine receptor is a neurotransmitter-gated ion channel. Binding of glycine to its receptor increases the chloride conductance and thus produces hyperpolarization (inhibition of neuronal firing).
  • Sequence similaritiesBelongs to the ligand-gated ion channel (TC 1.A.9) family. Glycine receptor (TC 1.A.9.3) subfamily. GLRA2 sub-subfamily.
  • Cellular localizationCell junction > synapse > postsynaptic cell membrane. Cell membrane.
  • Information by UniProt

Recombinant Human alpha 2 Glycine Receptor protein images

  • 12.5% SDS-PAGE Stained with Coomassie Blue showing ab114545.

References for Recombinant Human alpha 2 Glycine Receptor protein (ab114545)

ab114545 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114545.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"