Recombinant Human alpha 2 Macroglobulin protein (ab157817)
Key features and details
- Expression system: Wheat germ
- Tags: GST tag N-Terminus
- Suitable for: WB, ELISA
Description
-
Product name
Recombinant Human alpha 2 Macroglobulin protein -
Expression system
Wheat germ -
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
DCINRHNVYINGITYTPVSSTNEKDMYSFLEDMGLKAFTNSKIRKPKMCP QLQQYEMHGPEGLRVGFYESDVMGRGHARLVHVEEPHTET -
Amino acids
641 to 730 -
Tags
GST tag N-Terminus
-
Specifications
Our Abpromise guarantee covers the use of ab157817 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Western blot
ELISA
-
Form
Liquid -
Additional notes
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
pH: 8.00
Constituents: 0.31% Glutathione, 0.79% Tris HCl
General Info
-
Alternative names
- A2m
- A2MG_HUMAN
- Alpha 2 M
see all -
Function
Is able to inhibit all four classes of proteinases by a unique 'trapping' mechanism. This protein has a peptide stretch, called the 'bait region' which contains specific cleavage sites for different proteinases. When a proteinase cleaves the bait region, a conformational change is induced in the protein which traps the proteinase. The entrapped enzyme remains active against low molecular weight substrates (activity against high molecular weight substrates is greatly reduced). Following cleavage in the bait region a thioester bond is hydrolyzed and mediates the covalent binding of the protein to the proteinase. -
Tissue specificity
Secreted in plasma. -
Sequence similarities
Belongs to the protease inhibitor I39 (alpha-2-macroglobulin) family. -
Developmental stage
Contrary to the rat protein, which is an acute phase protein, this protein is always present at high levels in circulation. -
Cellular localization
Secreted. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab157817 has not yet been referenced specifically in any publications.