Recombinant Human alpha 2 Macroglobulin protein (ab157817)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      DCINRHNVYINGITYTPVSSTNEKDMYSFLEDMGLKAFTNSKIRKPKMCP QLQQYEMHGPEGLRVGFYESDVMGRGHARLVHVEEPHTET
    • Amino acids
      641 to 730
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab157817 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • A2m
    • A2MG_HUMAN
    • Alpha 2 M
    • Alpha 2M
    • Alpha-2-M
    • Alpha-2-macroglobulin
    • C3 and PZP-like alpha-2-macroglobulin domain-containing protein 5
    • CPAMD5
    • DKFZp779B086
    • FWP007
    • S863 7
    see all
  • Function
    Is able to inhibit all four classes of proteinases by a unique 'trapping' mechanism. This protein has a peptide stretch, called the 'bait region' which contains specific cleavage sites for different proteinases. When a proteinase cleaves the bait region, a conformational change is induced in the protein which traps the proteinase. The entrapped enzyme remains active against low molecular weight substrates (activity against high molecular weight substrates is greatly reduced). Following cleavage in the bait region a thioester bond is hydrolyzed and mediates the covalent binding of the protein to the proteinase.
  • Tissue specificity
    Secreted in plasma.
  • Sequence similarities
    Belongs to the protease inhibitor I39 (alpha-2-macroglobulin) family.
  • Developmental stage
    Contrary to the rat protein, which is an acute phase protein, this protein is always present at high levels in circulation.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • ab157817 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab157817 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab157817.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up