Recombinant human alpha 2a Adrenergic Receptor protein (ab54291)

Overview

Description

  • NatureRecombinant
  • SourceBaculovirus infected Sf9 cells
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceMGSLQPDAGNASWNGTEAPGGGARATPYSLQVTLTLVCLAGLLMLLTVFG NVLVIIAVFT SRALKAPQNLFLVSLASADILVATLVIPFSLANEVMGY WYFGKAWCEIYLALDVLFCTSS IVHLCAISLDRYWSITQAIEYNLKRT PRRIKAIIITVWVISAVISFPPLISIEKKGGGGG PQPAEPRCEINDQK WYVISSCIGSFFAPCLIMILVYVRIYQIAKRRTRVPPSRRGPDAVA AP PGGTERRPNGLGPERSAGPGGAEAEPLPTQLNGAPGEPAPAGPRDTDALD LEESSSSD HAERPPGPRRPERGPRGKGKARASQVKPGDSLPRRGPGAT GIGTPAAGPGEERVGAAKAS RWRGRQNREKRFTFVLAVVIGVFVVCWF PFFFTYTLTAVGCSVPRTLFKFFFWFGYCNSS LNPVIYTIFNHDFRRA FKKILCRGDRKRIV

Specifications

Our Abpromise guarantee covers the use of ab54291 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    competitive binding assays

  • FormLiquid
  • Additional notesThis product is an aliquot of membranes from Sf9 cells transfected with the human recombinant alpha 2a Adrenergic Receptor. The membranes will retain their original specific activity for several months when stored at -80 °C in the original packing solution.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 10% Glycerol, 1% BSA, 50mM Tris HCl, pH 7.4

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • ADA2A_HUMAN
    • ADRA2
    • ADRA2A
    • ADRA2R
    • ADRAR
    • Adrenergic alpha 2A receptor
    • Alpha 2 adrenergic receptor subtype C10
    • Alpha 2A adrenergic receptor
    • Alpha 2AAR subtype C10
    • Alpha-2 adrenergic receptor subtype C10
    • alpha-2-adrenergic receptor, platelet type
    • Alpha-2A adrenergic receptor
    • Alpha-2A adrenoceptor
    • Alpha-2A adrenoreceptor
    • Alpha-2AAR
    • ALPHA2AAR
    • OTTHUMP00000058849
    • ZNF32
    see all
  • FunctionAlpha-2 adrenergic receptors mediate the catecholamine-induced inhibition of adenylate cyclase through the action of G proteins. The rank order of potency for agonists of this receptor is oxymetazoline > clonidine > epinephrine > norepinephrine > phenylephrine > dopamine > p-synephrine > p-tyramine > serotonin = p-octopamine. For antagonists, the rank order is yohimbine > phentolamine = mianserine > chlorpromazine = spiperone = prazosin > propanolol > alprenolol = pindolol.
  • Sequence similaritiesBelongs to the G-protein coupled receptor 1 family. Adrenergic receptor subfamily. ADRA2A sub-subfamily.
  • Cellular localizationCell membrane.
  • Information by UniProt

References for Recombinant human alpha 2a Adrenergic Receptor protein (ab54291)

ab54291 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab54291.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"