Recombinant Human alpha 3 Sodium Potassium ATPase protein (ab152204)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      NWDDRTVNDLEDSYGQQWTYEQRKVVEFTCHTAFFVSIVVVQWADLIICK TRRNSVFQQGMKNKILIFGLFEETALAAFLSYCPGMDVALRMYPLKPSWW FCAFPY
    • Molecular weight
      37 kDa including tags
    • Amino acids
      879 to 984

Specifications

Our Abpromise guarantee covers the use of ab152204 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Sodium chloride

General Info

  • Alternative names
    • AHC2
    • Alpha(III)
    • AT1A3_HUMAN
    • Atp1a3
    • ATPase Na+/K+ transporting alpha 3 polypeptide
    • DYT 12
    • DYT12
    • MGC13276
    • Na(+)/K(+) ATPase alpha(III) subunit
    • Na(+)/K(+) ATPase alpha-3 subunit
    • Na+/K+ ATPase 3
    • Na+/K+ ATPase alpha 3 subunit
    • RDP
    • Sodium potassium ATPase alpha 3 polypeptide
    • Sodium pump 3
    • Sodium pump subunit alpha-3
    • Sodium/potassium transporting ATPase alpha 3 chain
    • Sodium/potassium-transporting ATPase subunit alpha-3
    see all
  • Function
    This is the catalytic component of the active enzyme, which catalyzes the hydrolysis of ATP coupled with the exchange of sodium and potassium ions across the plasma membrane. This action creates the electrochemical gradient of sodium and potassium ions, providing the energy for active transport of various nutrients.
  • Involvement in disease
    Dystonia 12
    Alternating hemiplegia of childhood 2
    Cerebellar ataxia, areflexia, pes cavus, optic atrophy, and sensorineural hearing loss
  • Sequence similarities
    Belongs to the cation transport ATPase (P-type) (TC 3.A.3) family. Type IIC subfamily.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152204 stained with Coomassie Blue.

References

ab152204 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152204.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up