Recombinant Human alpha Adducin protein (ab157856)

Overview

  • Product name
    Recombinant Human alpha Adducin protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MNGDSRAAVVTSPPPTTAPHKERYFDRVDENNPEYLRERNMAPDLRQDFN MMEQKKRVSMILQSPAFCEELESMIQEQFKKGKNPTGLLALQQIADFMTT NVPNVYPAAPQGGMAALNMSLGMVTPVNDLRGSDSIAYDKGEKLLRCKLA AFYRLADLFGWSQLIYNHITTRVNSEQEHFLIVPFGLLYSEVTASSLVKI NLQGDIVDRGSTNLGVNQAGFTLHSAIYAARPDVKCVVHIHTPAGAAVSA MKCGLLPISPEALSLGEVAYHDYHGILVDEEEKVLIQKNLGPKSKVLILR NHGLVSVGESVEEAFYYIHNLVVACEIQVRTLASAGGPDNLVLLNPEKYK AKSRSPGSPVGEGTGSPPKWQIGEQEFEALMRMLDNLGYRTGYPYRYPAL REKSKKYSDVEVPASVTGYSFASDGDSGTCSPLRHSFQKQQREKTRWLNS GRGDEASEEGQNGSSPKSKTKWTKEDGHRTSTSAVPNLFVPLNTNPKEVQ EMRNKIREQNLQDIKTAGPQSQVLCGVVMDRSLVQDAPLSDCTETIEGLE LTEQTFSPAKSLSFRKGELVTASKAIIEKEYQPHVIVSTTGPNPFTTLTD RELEEYRREVERKQKGSEENLDEAREQKEKSPPDQPAVPHPPPSTPIKLE EGDGCAREYLLP
    • Amino acids
      1 to 662
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab157856 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ADD A
    • ADD1
    • ADDA
    • ADDA_HUMAN
    • Adducin 1 (alpha)
    • Alpha adducin
    • Alpha-adducin
    • Erythrocyte adducin alpha subunit
    • Erythrocyte adducin subunit alpha
    • MGC3339
    • MGC44427
    • OTTHUMP00000151163
    • OTTHUMP00000151164
    • OTTHUMP00000151165
    • OTTHUMP00000218664
    • OTTHUMP00000218665
    see all
  • Function
    Membrane-cytoskeleton-associated protein that promotes the assembly of the spectrin-actin network. Binds to calmodulin.
  • Tissue specificity
    Expressed in all tissues. Found in much higher levels in reticulocytes than the beta subunit.
  • Sequence similarities
    Belongs to the aldolase class II family. Adducin subfamily.
  • Domain
    Each subunit is comprised of three regions: a NH2-terminal protease-resistant globular head region, a short connecting subdomain, and a protease-sensitive tail region.
  • Cellular localization
    Cytoplasm > cytoskeleton. Cell membrane.
  • Information by UniProt

Images

  • ab157856 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab157856 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab157856.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up