Recombinant Human Alpha B Crystallin protein (ab113180)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP02511
    • SpeciesHuman
    • SequenceMDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFSTATSLSPFYLR PPSFLRAPSWIDTGLSEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEV HGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRK QVSGPERTIPITREEKPAVAAAPKK
    • Molecular weight26 kDa including tags
    • Amino acids1 to 175
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab113180 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

  • Purity> 95 % SDS-PAGE.
    ab113180 was purified by multi step chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 7.50
    Constituents: 0.61% Tris, 0.47% Sodium chloride, 0.03% EDTA

General Info

  • Alternative names
    • AACRYA
    • Alpha B crystallin
    • Alpha crystallin B chain
    • Alpha(B)-crystallin
    • Alpha-crystallin B chain
    • CRYA2
    • Cryab
    • CRYAB_HUMAN
    • Crystallin alpha B
    • Crystallin alpha polypeptide 2
    • CTPP2
    • Heat shock 20 kD like protein
    • Heat shock protein beta 5
    • Heat shock protein beta-5
    • HspB5
    • Renal carcinoma antigen NY REN 27
    • Renal carcinoma antigen NY-REN-27
    • Rosenthal fiber component
    see all
  • FunctionMay contribute to the transparency and refractive index of the lens.
  • Tissue specificityLens as well as other tissues.
  • Involvement in diseaseDefects in CRYAB are the cause of myofibrillar alpha-B crystallin-related (MFM-CRYAB) [MIM:608810]. A neuromuscular disorder that results in weakness of the proximal and distal limb muscles, weakness of the neck, velopharynx and trunk muscles, hypetrophic cardiomyopathy, and cataract in a subset of patients.
  • Sequence similaritiesBelongs to the small heat shock protein (HSP20) family.
  • Cellular localizationCytoplasm. Nucleus. Translocates to the nucleus during heat shock and resides in sub-nuclear structures known as SC35 speckles or nuclear splicing speckles.
  • Information by UniProt

Recombinant Human Alpha B Crystallin protein images

  • SDS-PAGE analysis: Lane 1: MWM, Lane 2: 1μg ab113180, Lane 3: 2μg ab113180, Lane 4: 5μg ab113180.
  • Western Blot analysis: Lane 1: MW marker, Lane 2: ab113180, Lane 3: bovine native alpha A Crystallin, Lane 4: bovine native Alpha B crystallin. Left: probed with Alpha B crystallin antibody. Right: probed with alpha A crystallin antibody.

References for Recombinant Human Alpha B Crystallin protein (ab113180)

ab113180 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab113180.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"