Recombinant Human alpha crystallin protein (ab173018)

Overview

  • Product name
    Recombinant Human alpha crystallin protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MDVTIQHPWFKRTLGPFYPSRLFDQFFGEGLFEYDLLPFLSSTISPYYRQ SLFRTVLDSGISEVRSDRDKFVIFLDVKHFSPEDLTVKVQDDFVEIHGKH NERQDDHGYISREFHRRYRLPSNVDQSALSCSLSADGMLTFCGPKIQTGL DATHAERAIPVSREEKPTSAPSS
    • Molecular weight
      21 kDa including tags
    • Amino acids
      1 to 173
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab173018 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    ab173018 is greater than 95% pure, as determined by SEC-HPLC and reducing SDS-PAGE. It is supplied as an 0.2 µM filtered solution.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.06% EDTA, 99% PBS

General Info

  • Alternative names
    • crystallin alpha A
    • Heat shock protein beta 4
    • Hsp4
  • Relevance
    Alpha-Crystallin is the major component of the vertebrate lens.

References

ab173018 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab173018.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up