Recombinant Human alpha Lactalbumin protein (ab116809)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP00709
    • SpeciesHuman
    • SequenceDIDGYGGIALPELICTMFHTSGYDTQAIVENNESTEYGLFQISNKLWCKS SQVPQSRNICDISCDKFLDDDITDDIMCAKKILDIKGIDYWLAHKALCTE KLEQWLCEKL
    • Molecular weight38 kDa including tags
    • Amino acids33 to 142

Specifications

Our Abpromise guarantee covers the use of ab116809 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • a-LACTA
    • alfaLA
    • Alpha-lactalbumin
    • Lactalbumin alpha
    • Lactose synthase B protein
    • LALBA
    • LALBA_HUMAN
    • Lysozyme-like protein 7
    • LYZL7
    • MGC138521
    • MGC138523
    see all
  • FunctionRegulatory subunit of lactose synthase, changes the substrate specificity of galactosyltransferase in the mammary gland making glucose a good acceptor substrate for this enzyme. This enables LS to synthesize lactose, the major carbohydrate component of milk. In other tissues, galactosyltransferase transfers galactose onto the N-acetylglucosamine of the oligosaccharide chains in glycoproteins.
  • Tissue specificityMammary gland specific. Secreted in milk.
  • Sequence similaritiesBelongs to the glycosyl hydrolase 22 family.
  • Cellular localizationSecreted.
  • Information by UniProt

Recombinant Human alpha Lactalbumin protein images

  • 12.5% SDS-PAGE showing ab116809 at approximately 37.73kDa.
    Stained with Coomassie Blue.

References for Recombinant Human alpha Lactalbumin protein (ab116809)

ab116809 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116809.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"