Recombinant Human alpha Lactalbumin protein (ab116809)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      DIDGYGGIALPELICTMFHTSGYDTQAIVENNESTEYGLFQISNKLWCKS SQVPQSRNICDISCDKFLDDDITDDIMCAKKILDIKGIDYWLAHKALCTE KLEQWLCEKL
    • Molecular weight
      38 kDa including tags
    • Amino acids
      33 to 142

Specifications

Our Abpromise guarantee covers the use of ab116809 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • a-LACTA
    • alfaLA
    • Alpha-lactalbumin
    • Lactalbumin alpha
    • Lactose synthase B protein
    • LALBA
    • LALBA_HUMAN
    • Lysozyme-like protein 7
    • LYZL7
    • MGC138521
    • MGC138523
    see all
  • Function
    Regulatory subunit of lactose synthase, changes the substrate specificity of galactosyltransferase in the mammary gland making glucose a good acceptor substrate for this enzyme. This enables LS to synthesize lactose, the major carbohydrate component of milk. In other tissues, galactosyltransferase transfers galactose onto the N-acetylglucosamine of the oligosaccharide chains in glycoproteins.
  • Tissue specificity
    Mammary gland specific. Secreted in milk.
  • Sequence similarities
    Belongs to the glycosyl hydrolase 22 family.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab116809 at approximately 37.73kDa.
    Stained with Coomassie Blue.

References

ab116809 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116809.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up