Recombinant Human alpha smooth muscle Actin protein (ab114148)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP62736
    • SpeciesHuman
    • SequenceMCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMG QKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAP EEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRT TGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGY SFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVI TIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNV LSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILAS LSTFQQMWISKQEYDEAGPSIVHRKCF
    • Molecular weight67 kDa including tags
    • Amino acids1 to 377
    • TagsGST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab114148 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • a actin
    • AAT6
    • ACTA_HUMAN
    • ACTA2
    • Actin alpha 2 smooth muscle aorta
    • Actin aortic smooth muscle
    • Actin, aortic smooth muscle
    • ACTSA
    • ACTVS
    • Alpha 2 actin
    • Alpha actin 2
    • Alpha cardiac actin
    • Alpha-actin-2
    • Cell growth inhibiting gene 46 protein
    • Cell growth-inhibiting gene 46 protein
    • GIG46
    • Growth inhibiting gene 46
    • MYMY5
    see all
  • FunctionActins are highly conserved proteins that are involved in various types of cell motility and are ubiquitously expressed in all eukaryotic cells.
  • Involvement in diseaseDefects in ACTA2 are the cause of aortic aneurysm familial thoracic type 6 (AAT6) [MIM:611788]. AATs are characterized by permanent dilation of the thoracic aorta usually due to degenerative changes in the aortic wall. They are primarily associated with a characteristic histologic appearance known as 'medial necrosis' or 'Erdheim cystic medial necrosis' in which there is degeneration and fragmentation of elastic fibers, loss of smooth muscle cells, and an accumulation of basophilic ground substance.
  • Sequence similaritiesBelongs to the actin family.
  • Cellular localizationCytoplasm > cytoskeleton.
  • Information by UniProt

Recombinant Human alpha smooth muscle Actin protein images

  • 12.5% SDS-PAGE analysis of ab114148, stained with Coomassie Blue.

References for Recombinant Human alpha smooth muscle Actin protein (ab114148)

ab114148 has not yet been referenced specifically in any publications.

Product Wall

Thank you for your enquiry which has been forwarded to the scientific support team. I am sorry we do not provide larger vial sizes. We can offer a discount if you purchase 5 vials or more on one order (of the same product, or different products). I...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"