Recombinant Human Alpha SNAP protein (ab100963)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP54920
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMDNSGKEAEAMALLAEAERKVKNSQSFFSG LFGGSSKIEEACEIYARAANMFKMAKNWSAAGNAFCQAAQLHLQLQSKHD AATCFVDAGNAFKKADPQEAINCLMRAIEIYTDMGRFTIAAKHHISIAEI YETELVDIEKAIAHYEQSADYYKGEESNSSANKCLLKVAGYAALLEQYQK AIDIYEQVGTNAMDSPLLKYSAKDYFFKAALCHFCIDMLNAKLAVQKYEE LFPAFSDSRECKLMKKLLEAHEEQNVDSYTESVKEYDSISRLDQWLTTML LRIKKTIQGDEEDLR
    • Molecular weight35 kDa including tags
    • Amino acids1 to 295
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab100963 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab100963 is purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Tris HCl, pH 7.5

General Info

  • Alternative names
    • Alpha soluble NSF attachment protein
    • Alpha-soluble NSF attachment protein
    • N ethylmaleimide sensitive factor attachment protein alpha
    • N-ethylmaleimide-sensitive factor attachment protein alpha
    • napA
    • NSF attachment protein alpha
    • SNAA_HUMAN
    • SNAP alpha
    • SNAP-alpha
    • SNAPA
    see all
  • FunctionRequired for vesicular transport between the endoplasmic reticulum and the Golgi apparatus.
  • Sequence similaritiesBelongs to the SNAP family.
  • Cellular localizationMembrane.
  • Information by UniProt

Recombinant Human Alpha SNAP protein images

  • 15% SDS-PAGE showing ab100963 (3 µg) at approximately 35.3 kDa.

References for Recombinant Human Alpha SNAP protein (ab100963)

ab100963 has not yet been referenced specifically in any publications.

Product Wall

Thank you for contacting us last week and your interest in our products.

As discussed over the phone, we do not have the plasmid which was used to express the protein ab100963 in our catalogue. Unfortunately, I can now confirm that the source...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"