Recombinant Human Alpha Taxilin protein (ab185380)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMKNQDKKNGAAKQSNPKSSPGQPEAGPEGA QERPSQAAPAVEAEGPGSSQAPRKPEGAQARTAQSGALRDVSEELSRQLE DILSTYCVDNNQGGPGEDGAQGEPAEPEDAEKSRTYVARNGEPEPTPVVN GEKEPSKGDPNTEEIRQSDEVGDRDHRRPQEKLEHHHHHH
    • Molecular weight
      20 kDa including tags
    • Amino acids
      1 to 162
    • Tags
      His tag C-Terminus , His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab185380 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at Room Temperature. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 3X PBS.

General Info

  • Alternative names
    • Alpha-taxilin
    • DKFZp451J0118
    • IL 14
    • IL14
    • interleukin 14
    • MGC11887
    • MGC118870
    • MGC118871
    • RP4-622L5.4
    • Taxilin alpha
    • TXLN
    • TXLNA
    • TXLNA_HUMAN
    see all
  • Function
    May be involved in intracellular vesicle traffic and potentially in calcium-dependent exocytosis in neuroendocrine cells.
  • Tissue specificity
    Ubiquitous, with much higher expression in heart, kidney, liver and pancreas.
  • Sequence similarities
    Belongs to the taxilin family.
  • Information by UniProt

References

ab185380 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185380.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up