Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MRTQQKRDTKFREDCPPDREELGRHSWAVLHTLAAYYPDLPTPEQQQDMA QFIHLFSKFYPCEECAEDLRKRLCRNHPDTRTRACFTQWLCHLHNEVNRK LGKPDFDCSKVDERWRDGWKDGSCD
    • Molecular weight
      40 kDa including tags
    • Amino acids
      1 to 125

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114811 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ALR_HUMAN
    • Augmenter of liver regeneration
    • ERV1
    • ERV1 homolog
    • Erv1 like growth factor
    • FAD-linked sulfhydryl oxidase ALR
    • GFER
    • Growth factor augmenter of liver regeneration
    • Growth factor erv1 like
    • Hepatic regenerative stimulation substance
    • Hepatopoietin
    • Hepatopoietin protein
    • hERV1
    • HPO
    • HPO1
    • HPO2
    • HSS
    see all
  • Function
    Isoform 1: FAD-dependent sulfhydryl oxidase. Within the mitochondrial intermembrane space, participates in a chain of disulfide exchange reactions with MIA40, that generate disulfide bonds in a number of resident proteins with twin Cx3C and Cx9C motifs.
    Isoform 2: May act as an autocrine hepatotrophic growth factor promoting liver regeneration.
  • Tissue specificity
    Ubiquitously expressed. Highest expression in the testis and liver and low expression in the muscle.
  • Involvement in disease
    Defects in GFER are a cause of mitochondrial progressive myopathy with congenital cataract hearing loss and developmental delay (MPMCHD) [MIM:613076]; also called combined mitochondrial complex deficiency.
  • Sequence similarities
    Contains 1 ERV/ALR sulfhydryl oxidase domain.
  • Cellular localization
    Mitochondrion intermembrane space and Cytoplasm. Secreted.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE Stained with Coomassie Blue

References

ab114811 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114811.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up