Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MRTQQKRDTKFREDCPPDREELGRHSWAVLHTLAAYYPDLPTPEQQQDMA QFIHLFSKFYPCEECAEDLRKRLCRNHPDTRTRACFTQWLCHLHNEVNRK LGKPDFDCSKVDERWRDGWKDGSCD
    • Molecular weight
      40 kDa including tags
    • Amino acids
      1 to 125

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114811 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ALR_HUMAN
    • Augmenter of liver regeneration
    • ERV1
    • ERV1 homolog
    • Erv1 like growth factor
    • FAD-linked sulfhydryl oxidase ALR
    • GFER
    • Growth factor augmenter of liver regeneration
    • Growth factor erv1 like
    • Hepatic regenerative stimulation substance
    • Hepatopoietin
    • Hepatopoietin protein
    • hERV1
    • HPO
    • HPO1
    • HPO2
    • HSS
    see all
  • Function
    Isoform 1: FAD-dependent sulfhydryl oxidase. Within the mitochondrial intermembrane space, participates in a chain of disulfide exchange reactions with MIA40, that generate disulfide bonds in a number of resident proteins with twin Cx3C and Cx9C motifs.
    Isoform 2: May act as an autocrine hepatotrophic growth factor promoting liver regeneration.
  • Tissue specificity
    Ubiquitously expressed. Highest expression in the testis and liver and low expression in the muscle.
  • Involvement in disease
    Defects in GFER are a cause of mitochondrial progressive myopathy with congenital cataract hearing loss and developmental delay (MPMCHD) [MIM:613076]; also called combined mitochondrial complex deficiency.
  • Sequence similarities
    Contains 1 ERV/ALR sulfhydryl oxidase domain.
  • Cellular localization
    Mitochondrion intermembrane space and Cytoplasm. Secreted.
  • Information by UniProt

Recombinant Human ALR protein images

  • 12.5% SDS-PAGE Stained with Coomassie Blue

References for Recombinant Human ALR protein (ab114811)

ab114811 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114811.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up