Recombinant Human ALS2CR15 protein (ab165321)

Overview

  • Product name
    Recombinant Human ALS2CR15 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MDSFGQPRPEDNQSVVRRMQKKYWKTKQVFIKATGKKEDEHLVASDAELD AKLEVFHSVQETCTELLKIIEKYQLRLNVISEEENELGLFLKFQAERDAT QAGKMMDATGKALCSSAKQRLALCTPLSRLKQEVATFSQRAVSDTLMTIN RMEQARTEYRGALLWMKDVSQELDPDTLKQMEKFRKVQMQVRNSKASFDK LKMDVCQKVDLLGASRCNMLSHSLTTYQRTLLGFWKKTARMMSQIHEACI GFHPYDFVALKQLQDTPSKISEDNKDEQIGGFLTEQLNKLVLSDEEASFE SEQANKDHNEKHSQMREFGAPQFSNSENVAKDLPVDSLEGEDFEKEFSFL NNLLSSGSSSTSEFTQECQTAFGSPSASLTSQEPSMGSEPLAHSSRFLPS QLFDLGFHVAGAFNNWVSQEESELCLSHTDNQPVPSQSPKKLTRSPNNGN QDMSAWFNLFADLDPLSNPDAIGHSDDELLNA
    • Amino acids
      1 to 482
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165321 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ALS2CR14
    • ALS2CR15
    • ALS2CR15 protein
    • amyotrophic lateral sclerosis 2 (juvenile) chromosome region, candidate 15
    • Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 14 protein
    • Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 15 protein
    • amyotrophic lateral sclerosis 2 juvenile chromosome region candidate 14
    • amyotrophic lateral sclerosis 2 juvenile chromosome region candidate 15
    • DKFZp434E1919
    • Hypothetical protein DKFZp434E1919
    • Ica1l
    • ICA1L_HUMAN
    • Ica69 related protein
    • Ica69-related protein
    • islet cell autoantigen 1 69kDa-like
    • Islet cell autoantigen 1-like protein
    • LOC130026
    • MGC138440
    see all
  • Sequence similarities
    Contains 1 AH domain.
  • Information by UniProt

Images

  • ab165321 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165321 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165321.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up