Recombinant Human ALS2CR8 protein (ab164117)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      CLTQNNSTASTMGNLPEPDQNLVAMDELVEVGDVEDTGNLEGTVHRILLG DVQTIPIQIIDNHSALIEENPESTISVSQVKQEPKEPALSMEAKNCGL
    • Amino acids
      621 to 718
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164117 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Amyotrophic lateral sclerosis 2 (juvenile) chromosome region candidate 8
    • Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 8 protein
    • Calcium response factor
    • Calcium-response factor
    • Calcium-responsive transcription factor
    • CaRF
    • CARTF_HUMAN
    • Testis development protein NYD SP24
    • Testis development protein NYD-SP24
    see all
  • Function
    Acts as a transcriptional activator that mediates the calcium- and neuron-selective induction of BDNF exon III transcription. Binds to the consensus calcium-response element CaRE1 5'-CTATTTCGAG-3' sequence.
  • Domain
    The N-terminus is necessary for DNA-binding. The C-terminus is necessary for transcriptional activation (PubMed:11832226).
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab164117 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164117 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164117.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up