Overview

  • Product name
    Recombinant Human ALX3 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      KSKKRRNRTTFSTFQLEELEKVFQKTHYPDVYAREQLALRTDLTEARVQV WFQNRRAKWRKRERYGKIQEGRNPFTAAYDISVLPRTDSHPQLQNSLWAG
    • Amino acids
      150 to 249
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab157882 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ALX 3
    • ALX3 homeobox 3
    • Aristaless like homeobox 3
    • FND1
    • Homeobox protein aristaless like 3
    • MGC138212
    • MGC141988
    • Proline rich transcription factor ALX3
    see all
  • Relevance
    ALX3 (aristaless-like homeobox 3) is a nuclear protein with a homeobox DNA-binding domain. It functions as a transcriptional regulator with a possible role in patterning of the mesoderm during development. Preferential methylation of the ALX3 promoter is associated with advanced-stage neuroblastoma tumors.
  • Cellular localization
    Nuclear

Images

  • ab157882 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab157882 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab157882.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up